Aeromonas salmonicida A449 uid58631

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|145297142|ref|YP_001139983.1| glutathione oxidoreductase [Aeromonas salmonicida subsp. salmonicida A449]
    MAQHFDYIAIGGGSGGIASANRAAMYGKKVALIEAKELGGTCVNVGCVPKKAMWYAGQIADALKYGADYGFDTTLNQFSW
    AKLVESRQAYIGRIHQSYQNVLGKNQITVVKGFARFVNSNTIEVNGEQYTADHILIATGGRPEVPTIPGAELGIDSDGFF
    DLQAQPKRVAVVGAGYIAVEIAGVMQALGSETHLVVRKHAPLRNFDPMIHETLVEIMAQEGPKLHTHATPKAVIKNADDS
    LTLQLEDGRHLTVDCLIWAIGRTPATDNLDLTAAGIELDDKGFIPTDKFQNTAVANVYAVGDNTGRIQLTPVAVAAGRRL
    SERLFNNKPNEHLDYNLVPTVVFSHPPIGTIGLTEPEAIAEYGESQVKVYRSQFTAMYSALTQHRQPTRMKLVCVGPEEK
    VVGLHGIGFAMDEILQGFGVAMKMGATKADFDNCVAIHPTSAEEFVTMR

    >gi|145297209|ref|YP_001140050.1| copper-translocating P-type ATPase [Aeromonas salmonicida subsp. salmonicida A449]
    MTTQIQDPIHLQLPLSGMSCANCASRISTALNQLEGVTATVNFALEQAAIELSDPARLPEVLDSITGQGYGYGHETLSFQ
    IRGMT
    CAGCSARLNKMLAALPGVISAEVNFSIEQARIELVPGMQTPASLRERIEALGFGAQLAQGSASGRRQQLQEREAQ
    EAAAAHQALLQVVISALLTLPLLVGMIAMAGLLPWHMPAWLELVLATPVQFWIGARFYRGAWLAIKNRSANMDVLVATGT
    SAAYFYSLYLLLTLGVAASGKLYFEASAIIITLISLGKLLEARARRSTQSAIRELMALRPETATVWRGERWQSLAIDEVL
    RGDRLRVLVGERVPVDGKIVSGASDLDESILTGESLPVPRGIGEGVLGGAINRSGVLEIEATTVGEDSSLSKIIVLVESA
    QMGKAPLQQLVDKVSAVFVPVVMAIALFTLLVWYAIGNDFGQALLAAVAVLVIACPCALGLATPAAIVTGTGVAARHGIL
    IKDVDTLQKAHAIKALIFDKTGTLTQGRPVLASWSGNDEQLRLAAALQQASEHPLALAMREAVGKEVVLPQPDEVEVRVG
    AGILGKVAGHSVAIGNASLLAQLGIDQSLQDEEPADGATRVWVAIDGVAVGIAALADTLRPESPEAIATLRQRGIASWLV
    SGDAPAPVAHIAGKLGLDGAFDSVLPAGKVDKVEALRARTQGLVAMVGDGVNDAPALAAADVGIAMGSGSDVAMETASIT
    LMRSDPRLVADAIDISAATWRTIQQNLFWAFVFNIIGIPLAALGYLSPELAGAAMALSSITVLSNSLLLKRWQPKAAHTS
    ALIQIGKET

    >gi|145297215|ref|YP_001140056.1| thiol-disulfide interchange protein [Aeromonas salmonicida subsp. salmonicida A449]
    MKKVLFFLAAMLMIPMVHAAPEFKEGVNYDVVKQTGSAQPEVVEFFSYYCPHCATFEPIVEQLKAGMPEGVPLKKNPVAF
    LGREMGPEMQRAYALASLLNVEAKLTPAIFNKIHTQRQYPQSRADVKQIFLDNGVPAEEFDGAVDSFAVSGMVSQFDRNT
    ESYNIRGVPAFLVNGKYMVKIESITSQEQFSQLVNFLLAKKD

    >gi|145297287|ref|YP_001140128.1| hypothetical protein ASA_0185 [Aeromonas salmonicida subsp. salmonicida A449]
    MKLINTFATELPWACEPVVPQPLREPRLLHLNRGLLAELGLDGVSDTDWLACCGLGQPLPGMQPVAQVYAGHQFGGYSPR
    LGDGRALLLGEQLATDGQRWDLHLKGAGKTPFSRFGDGRAVLRSSIREYLASEALHALGIPTTRALVLVGSKEPVYREQE
    ETGATVLRTAPSHLRFGHIEYFAWSGQGEKIPALIDYLLRYHFPELENGAELFAEVVRRTARLIAKWQAAGFCHGVLNTD
    NMSLLGLTLDYGPYGFIDAYVPDFVCNHSDPDGRYALDQQPAVGYWNLQKLAQALAGHVDGDALATSLAQYEHQLMLHYS
    ELMRAKLGLTQWEEEDPALFRQLFQLLASQGVDYHLFLRRLGEVTGTGEWPASLLALLPDPDLWQGWLELYRVRLTREGG
    EDAVRKAQMDAINPKYVLRNALAQQAIDAAEGGDMTQFERLLAALQQPYDEQPEYADLATPVPQWYCGGELS
    CSS

    >gi|145297340|ref|YP_001140181.1| coenzyme A disulfide reductase [Aeromonas salmonicida subsp. salmonicida A449]
    MRILIIGGEAAGMSAAAKARRLAKDAEIVVYEASEVISFGACGLPYFVGDEFQEPGYMAEFTPEQFAAKGIEVKTGHRVL
    SLDASAGTVQVEHQGDVFTDTYDRLMVATGAREVMPPIPGLQQQGVFGLRRMADGLALKAAVQDKRNTRALVIGSGFIGL
    EVVEALVHQGKEVRLIELADRVIPDAFDSEITRHIETELREQGVCVHLGERVEALLGDGRVTGVRTDKGEYEADIVVVCT
    GVKPNTEFLADTGIKRLANGAIEVDRQGRTSLANVWSAGDCASVWHSVKQQQVYVPLATIANKLGRMVGENLAGAEQVFP
    GTLGSAALKVLGLEAGRTGLSEQEAQAMGIDYRTVVIKDKCHTNYCPGQSDIHVKLVYEAGSKRLLGGQILGRKGAVHRI
    DALAVAITMGVTTEQLGMLDFAYAPPFSRTWDVLNVAGNVAK

    >gi|145297382|ref|YP_001140223.1| intracellular sulfur oxidation protein DsrE [Aeromonas salmonicida subsp. salmonicida A449]
    MSLSFALLVTGPAYGTQSASTAYRFALSLIEQGHRLSHLFFYQDGVCNGNELHAPASDESNLVALWRELAIGQGIRIDVC
    VAAAMRRGVLDETEAKGAGKVQFNLQAPFCLSGLGQLAEASLTADRFVQF

    >gi|145297507|ref|YP_001140348.1| dihydrolipoamide dehydrogenase [Aeromonas salmonicida subsp. salmonicida A449]
    MMSKEIKTQVVVLGAGPAGYSAAFRAADLGLDTIIVERYSTLGGVCLNVGCIPSKALLHVAKVIEEAKALSEHGIIFGAP
    QTDIDKVRLWKEKVINQLTGGLAGMAKMRKVQVVNGFGKFTGPNTLEVDGADGKTTVTFDNAIIAAGSRPVKLPFIPHDD
    PRVWDSTDALELTSVPGKLLVIGGGIIGLEMGTVYSSLGSEIDVVEFADQLVPAADKDIVKIYTKRVAKKFNIMLETKVT
    AVEARADGLYVSYEGKHAPAEPVRYDNVLVAVGRVPNGKLMDAEKAGVAVTERGFIEVDKQLRTNVAHIHSIGDIVGQPM
    LAHKGVHEGHVAAEVIAGKKHYFDPKVIPSIAYTEPEMAWVGLTEKEAKQQGLNFEVATFPWAASGRAIASDCSDGMTKL
    IFDKESGRVIGGAIVGTNGGELLGEIGLAIEMGADAEDIALTIHAHPTLHESVGLAAEVFEGSITDLPNAKAKKKK

    >gi|145297552|ref|YP_001140393.1| hypothetical protein ASA_0473 [Aeromonas salmonicida subsp. salmonicida A449]
    MTIELTISGMSCGGCAASLQKVLLAQSAVTQAQVDFASSKAVVESELSKAELIALIETKGFSAS

    >gi|145297615|ref|YP_001140456.1| copper-sensitivity suppressor D protein [Aeromonas salmonicida subsp. salmonicida A449]
    MEAKPSLPHRLRRWGKEALWLLLFGVVISTALDFWRSPALPEGNPLPTLTLQDGTTADLQAMSRDKPLLVYYWASWCAVC
    RFTTPTVEQLWQDGENVLTVALRSGNTQQLSKGMGKKGLTFPTHNDERGDLAARWQVSVTPSFLIVKDGKVVSTTTGWSS
    GLGLKLRLAWASLG

    >gi|145297616|ref|YP_001140457.1| copper-sensitivity suppressor C protein [Aeromonas salmonicida subsp. salmonicida A449]
    MANPKILDEVADAWEKQNAADQANQLGNFIKGNQDVLFNSATSPRLGAKNPKLTLVSFTDYNCPFCKQFDPHLARLLKAY
    PNDVGLVIKLLPFKGQTSAKAAQYSLTLWQQDPARFLALHDKLMSKQGMLTEADINKALAATGNAALKPEARATEELRNS
    LRIGTLLGVQGTPATLIGNQLVSGAIPYEELEQIVKAELARKG

    >gi|145297617|ref|YP_001140458.1| copper-sensitivity suppressor B protein [Aeromonas salmonicida subsp. salmonicida A449]
    MSNIIKTALLMGGLLWQSMGLASDTGWLASPQNDHAKVRLQADTRDPAQTRVLLSLELESGWKTYWQNPGEGGIAPEIFW
    DAPQATQQWHWPVPERFDVSGISTQGYQKTVSLPITLAHSSSDALTGTLRLSTCSNVCILTDYPFTLALDGTTPEGFDFA
    YAQAMSKLPQTLPDTVILKAGYQQNQLQLTADNPQGWQDPQIFLQKLEGAEFGKPELEVQGNTLIARIPVSDGWQGDAPD
    IRNQQLGFVLANGEQAWQSEFHIGDPLTLPSQGHSMLWLLGAALLGGLILNLMPCVLPVLALKLGSVLQLETRERRPVRL
    QFLAASAGILVSFWALALMSTLLRATQGAVSWGIQFQSVWFIGFMVVVTLLFCANLLGLFELRLPSNLNTRLATTGGNSL
    GGHFLQGCFATLLATPCSAPFLGTAVAFALGAPLGQLWLIFTALGIGMSLPWLLIAAFPRLALWLPKPGRWMRRLRILLG
    LMMLGSSLWLLSLLGNHIGQFWMLILMALMLAALLLAVVWRHGIRGVTLGLALTCLVGGALLLGGAFTMEGKPQRDTVNW
    QPLSEQAIVDALAQNKPVFVDVTADW
    CITCKANKFNVLLRDDVQKALSAPDVVALRGDWSRPSASIADFLRQRGSVAIPF
    NQIYGPGLLGSEILSPLLDRPTLLGTLKQAAIAPSQGDTK

    >gi|145297646|ref|YP_001140487.1| arsenate reductase [Aeromonas salmonicida subsp. salmonicida A449]
    MHNNQITIYHNPACGTSRNTLELIRNSGVEPTVVHYLETPPSRETLVALIGAMGMPVRDLLRKNVPPYEALELAENRFSD
    GDLIDAMLAHPILINRPIVVTPLGTRLCRPSEVVLDILPSPQQGAFTKEDGEQVVDAAGNRIK

    >gi|145297699|ref|YP_001140540.1| zinc/cadmium/mercury/lead-transporting ATPase [Aeromonas salmonicida subsp. salmonicida A449]
    MSKSCCSHQHTAATGKAVTSQVEHQHDSHCCDNVEQVSCCASKAPHDHQDQGVSESPGDEEPPRGSCQSQGCCSPQPPHD
    HDHDHDHHEHDHHEQTTDTAEPLVAPEQDSRRHSWQVLGMD
    CPSCARKIETAVSRVAGVQQARVLFATEKLVVDLAPGLS
    PDPVTAAVLAAGFRLKGATQPGDDNARRRSPQMALLAKYWQPLSLAGLMLLAALLPKEFGQPLFTLATLWGLWPISRKAW
    ALTRSGSPFAIETLMTVAALGALFLGETAEAAMVLLLFMLGEHLEAYAAGRARAGVTALMALVPDKALRIRTRVDGDVRE
    EVAADQLRPGDIIEIAPGARLPADARLLDALGAFDESALTGESIPVERRQGDKVPAGSLAADRVLRLEVVSEPGNNAIDR
    ILHLIEEAETQRAPIERFIDRFSRWYTPAMMLVALLVVIVPPLAFGQSWDEWVYRGLALLLIGCPCALVISTPAAVTSAL
    AAATRQEALIKGGAALERLAHIDTVAFDKTGTLTLGKPQLTELVSLNDQPEDELLALAAAIEQGSHHPLARAVVAAAREQ
    GLTLAAAQDLRALPGMGVEGRVDGTLWQLLAPSRIDSLSNALNAQIATLEQQGKTVVVLGQPGAAPAALLALRDQIRPEA
    AAALAELKGLGLRSIMLTGDNPRAAEAIANELGMGWRASLLPEDKVEEIAKLAASQKVAMIGDGINDAPAMKRANIGIAM
    GGGTDVALETADAALTHNQLGGIAAMIRLSRAALANIHQNIALALGLKAIFLVTSLLGITGLWIAVLADTGATALVTANA
    LRLLRKR

    >gi|145297700|ref|YP_001140541.1| peroxiredoxin [Aeromonas salmonicida subsp. salmonicida A449]
    MSNSVTLQGNPVSVAGHFPVAGEQAKPFSLVAKDLSDVTLASFAGQRKILNIFPSVDTPTCATSVRKFNEQASALENTVV
    LCISADLPFAQSRFCGAEGLDKVVTLSTLRGAAFMQDYGVAFSSGPLVGLTARAIVVLDADNKVLHSEMVAEVADEPNYA
    AALAAL

    >gi|145297714|ref|YP_001140555.1| glutathione peroxidase [Aeromonas salmonicida subsp. salmonicida A449]
    MKWFTLLLLLGVGTASAACPDYFNVEQRELNSTQRHNLCQLTEGKVVLVVNTASYCGYRGQFGDLETLYQTYKDKGLIVL
    GFPSNDFWQESGDEDKTAAVCRRDYGVTFPMFNRLAARGDDASPLYKGLAAAAGEAPGWNFHKYLIGRDGKLIASYGANQ
    NPADDPLQKEVKRALGL

    >gi|145297717|ref|YP_001140558.1| methylated-DNA-[protein]-cysteine S- methyltransferase [Aeromonas salmonicida subsp. salmonicida A449]
    MREDEIQFLRQRPRPPAHRHRSGWLRHVEFMQGERPIMPTQQWRQDDLALAPYVEQFAAYFAGRLQRFDLPLAAKGTPFQ
    QSVWRALCDIPYGKTVSYLEIAQSIGNHKAVRAVGAANGRNPLSIIVP
    CHRVIGRSGELTGYAGGIPIKRWLLALEQQNA
    SSFELTP

    >gi|145297824|ref|YP_001140665.1| peptide methionine sulfoxide reductase [Aeromonas salmonicida subsp. salmonicida A449]
    MSNNNPEQWRNKLSSEQFRVCWEKGTEQPYSGALLHNRKSGDYLCVCCKSMLFHSDAKFDSGCGWPSFDRAIEGTVTYTE
    DSSHGMKRVEITCSQCGSHLGHVFPDGPTETGQRY
    CVNSLSLDFDPDA

    >gi|145297861|ref|YP_001140702.1| iron-sulfur cluster insertion protein ErpA [Aeromonas salmonicida subsp. salmonicida A449]
    MSAVAEAPLPIQMTDAAANKVKNLITEEENPELKLRVYITGGGCSGFQYGFTFDEKINEGDTVVEKSGVTMVIDPMSLQY
    LVGGSVDYTEGLEGSRFTVTNPNASTTCGCGSSFSI

    >gi|145297893|ref|YP_001140734.1| thiosulfate sulfur transferase [Aeromonas salmonicida subsp. salmonicida A449]
    MNRENIMKAYIGLLRTGLTALLLWCALPAFAAELPPLSLADAKAKQAVILDTRASHFYQGWPMEGEKQGGHVAGAENLSA
    DWKYSDDEWPKALEIKGLKADRPVALYGEPREVAEVARLLRKQGIKQLFELQAWKAAPREYLARWQQLVYPRWLADLQEG
    KPVVAAPKGEWKLFEVDWGSPKAYLISHIPGAGYIDTNRLEEEPLWNKVSDEALKALLLENGIRHDTTVILYGRNTMAAA
    RAAHLMMYAGVADVRLLDGGLDAWFVQHLRTETGLPNKFEPVKEFGVAIPAHPEYYTTLDQAKALLKQPDSALVSVRTWD
    EFVGNTSGYSYIKPKGDIPGAKWGRGGVDANSMSDFHNPDGTMKPAREILTMWDEWNIEPTQQAAFY
    CGTGWRASEAFFY
    AWLMDWKRISVYDGGWYEWSADPANPTVTGERQPAKS

    >gi|145298051|ref|YP_001140892.1| hypothetical protein ASA_1017 [Aeromonas salmonicida subsp. salmonicida A449]
    MNQHIVIIANGAPYGSESLFNTLRLAIALNEQGGASLQLFLMSDAVSAALAGQAPAEGYNLRQMLEILLAQGTAIRLCKT
    CTDARGITALPLIEGIEIGTLPLLAQWTLAADKVLTF

    >gi|145298069|ref|YP_001140910.1| thiol:disulfide interchange protein DsbC [Aeromonas salmonicida subsp. salmonicida A449]
    MSKRVKHLLLGMMLLCTFAASAGMDPQLLKQRIEQRLGVQVYLVDATPMPGLFMLGTSQGPLYADARGDYVLQGIMLDLG
    HDMKNLTMLGQRQRQQRQRALAQIGERRMQLKAEPERHSVTLFTDLT
    CRNCRTALDELPILQAQGVSVQLLPALGTFADV
    AEVQARWCDPALFSELSLSDRLPATGCNEILAHHIGLSQWLGIKALPSWVLPNGDLVRGYQSPEQLLKILDHINAPANPS
    SSAS

    >gi|145298268|ref|YP_001141109.1| peroxiredoxin [Aeromonas salmonicida subsp. salmonicida A449]
    MIAIGQTLPAGEFTFITAEGKQVQDSQALFAGKTVILFAVPGAFTPTCSNAHLPGYVVLADQFKAKGVDAIYCLSVNDAF
    VMKAWQVAQNADAITMLADGDGSWTQALGLAKETGAFGGLRAQRFALIALDGVVTRLFVEAPGKFEVSDASSLLAAL

    >gi|145298308|ref|YP_001141149.1| thioredoxin-like protein [Aeromonas salmonicida subsp. salmonicida A449]
    MIVDINPQNFQAALIDASMKKPVVIYFHAPQMPECQGMTPLVESLVGPDNPQVTLAKVDMNDPQLQPLASQLGLRALPAL
    VLFHQGRPDEQAILEGPQDEATLRHYFAAFAPKEEELLFEKGQQALADDQADVAYAHLTKAHQLAPDRHDISLWLIQAAL
    DINLLDEAQERLGKIPMAAQDDHYQTLSSRLALALQAADSPELRALEARYEQEPDNFTLTQELAVQYSQAGRQEEALALL
    FTILKRDLAFGDAKKTYLDILTTMGAHPAAQSYRRKLYSLLY

    >gi|145298380|ref|YP_001141221.1| thiol:disulfide interchange protein DsbE [Aeromonas salmonicida subsp. salmonicida A449]
    MNKKTWLFLIPFIIFLLGAVFLFKGLYSDPTKLESVMVDKEVPVFTLQDIYDLNKQHDRSILKGRPMLLNVWATWCPTCY
    GEHTYLKQLAEQGIPIVGMNYKDERDKAIRWLTELGNPYQVNLYDPDGMLGLDLGVYGAPETFFIDSQGIIRYRHVGDVN
    PQVWATTLKPIFESMK

    >gi|145298385|ref|YP_001141226.1| glutaredoxin-like protein [Aeromonas salmonicida subsp. salmonicida A449]
    METIEKIKQQLADNPIILYMKGSPKLPSCGFSAQASQALMSCGEPFAYVDILQNPDIRAELPKFANWPTFPQLWVEGELV
    GGCDILIEMFQAGELQTLIKETAAKHKQDDVAAE

    >gi|145298674|ref|YP_001141515.1| glutaredoxin 1 [Aeromonas salmonicida subsp. salmonicida A449]
    MFAVIFGRPGCPYCVRAKQIAEQLVEQRDDFNFRYVDIHAEGITKEDLAKSAGKPVNTVPQIFLDEQHIGGCTDFEAYAK
    ENLGLYQ

    >gi|145298958|ref|YP_001141799.1| cation transporter E1-E2 family ATPase [Aeromonas salmonicida subsp. salmonicida A449]
    MKACFHCGEPVPAASHYALEIKGIVEPMCCPGCQAVAETIMECGLSSYYDHRTAPGTRGELVPEELAALTHYDLAEVQQD
    FVTNSGTGSHRVREIQLSVEGLT
    CAACAWLIERHLTGLAGLHYINVNTTTHRARIMWDPDQLSLSDILKGFAKIGYRAYP
    FQTHTQEAIYAKEVRNYMFRLALAGLGSMQVMMCAVALYMDLFISVEDEFMVYFKWISLLLSTPIMIYSAQPFYVGAWRS
    LKQGHLSMDVSVSLALIGAFVASMWATVFNTGEVYYDSITMFVFFLLLGRFLELRARRKASESSSNLARLVPIMATRIDE
    EGEHEVAAKTLQVGDRVRVLAGATLPADGIIVEGQASLNESMLTGEQLPLLKQVGDSVYAGTINTDAPLQIRVSHRIEES
    RIAQIMRLQDHALDDKPAIAQMADVLSRHFILVLLIIAAAVWTFWHFHQPEQAFWVTLAVLVATCPCALSLATPTALTSA
    TARLTRSGILLRRGHVLDVLTKANRIVMDKTGTLTTGNISLTSTTALAELSEDQCLAIARALEAYSEHPIARAFKSTAAD
    DVLLPASEVVPVIGHGIEGCVAGKHYRIGSARWLALPTEHTASQGLAIYLADESRVLARFILADTLRPDARALLQAFKAA
    GLQTTILTGDSSAQADEVARELGVDELVKGVTPDGKLAYLKAREAQGDISIMVGDGINDAPVLAGAHASFAMAGGTDLAK
    NSADAILLADDLSRLLDARTLAIRTRKIIKENFAWSIGYNLLVLPLAASGWLPPYLAAAGMSLSSLIVVTNSMRLNR

    >gi|145299050|ref|YP_001141891.1| selenide, water dikinase [Aeromonas salmonicida subsp. salmonicida A449]
    MSSIRLTQYSHGAGCGCKISPKVLDTILKSQIPGFDDPTLVVGNSSKDDAAVVDIGNGQGIVSTTDFFMPIVDDPFTFGR
    IAATNAISDIYAMGGKPIVAIAILGWPINTLAPEIAQQVIDGGRQVCHEAGISLAGGHSIDAPEPIFGLAVTGIVPLDAI
    KQNDTAQAGDILYLTKPLGIGILTTAQKKGKLKPEHEQLAPNAMCTLNKIGQRFAELPGVHAMTDVTGFGLAGHLLEMCE
    GSGVCATLDFKALPLLDEVDYYLSEGCVPGGTLRNFDSYGAKLGAMDERTRNIMCDPQTSGGLLVAVGKESEAELLAIAT
    QAGLTLSPIGQLKAYTGNQFIEVIQ

    >gi|145299221|ref|YP_001142062.1| glutathione peroxidase [Aeromonas salmonicida subsp. salmonicida A449]
    MSLPDLPLQRLDGTEFSLTALQGQVILVVNVASRCGFTPQYTGLEALYQQLGPKGLVILGFPCDQFGHQEPGDADEIARF
    CSLDYPVSFPIMAKCEVNGEHAHPFYRWLKQQKPGLLGLENVKWNFTKFLINREGEVVERFAPQTKPESLLDEISALL

    >gi|145299244|ref|YP_001142085.1| thioredoxin 2 [Aeromonas salmonicida subsp. salmonicida A449]
    MSFITTYCSHCFTRNRLPAEKMDSNAKCGRCKSSLFGITPVIGREDQFDILIQSDLPVVVDFWASWCGPCLQFSPIFQQV
    ASELKPHFRFVKVDTEQQAAIAARYAIRSIPTLMIFKQGKMVAQRSGSLPKSLFKEWVASVA

    >gi|145299260|ref|YP_001142101.1| disulfide bond formation protein B [Aeromonas salmonicida subsp. salmonicida A449]
    MIEFLRRIAAHRLAWGLLAASALFLELSALFFQYVLGLHPCVMCVYERLAILGVLSAGLLGMVAPEKWYLRWSALLLWGY
    SAFRGLQLALKHVDYQMNPSPFNV
    CSPFADFPSWAPLDQWLPWLFFPDGDCSEISWQFLSFSMPQWLVAIFAAYLLVFVV
    VTIGNLVKGRCCS

    >gi|145299282|ref|YP_001142123.1| formate-dependent nitrite reductase complex subunit NrfF [Aeromonas salmonicida subsp. salmonicida A449]
    MSPRLRLFLPLLLTLGLGTLLWLGLANNPYRQDEATLGRTLPQWQSENLLDGGLVHTDQLKGEPFVLNVWASWCPNCRAE
    HPLLAELASTVPLYGLNYRDKGEAARAWLGEAGNPYRAVLADSDGKLALELGVYGTPETYLFAADGTLLTRHTGLLTTDI
    WQRQFVPKLKAARATTLTSSTTTGQEGKP

    >gi|145299390|ref|YP_001142231.1| thioredoxin reductase [Aeromonas salmonicida subsp. salmonicida A449]
    MSQVTHSKLLILGSGPAGYTAAVYAARANLNPLLITGMQQGGQLTTTTEVENWPGDSEGLTGPALMERMKAHAEKFDTRI
    LFDHINEVELTQRPFRLKGDSAEYTCDALIIATGASAKYLGLPSEEAFKGRGVSA
    CATCDGFFYRNQEVAVIGGGNTAVE
    EALYLANIAKKVHLIHRRDEFRAEKILIKLLHDKVASGNIVLHTHQTLDEVLGDQMGVTGVRLRSTQDDTTTDLPLMGVF
    IAIGHQPNTQIFEGQLAMQNGYLIVRGGLDGFATQTSIEGVFAAGDVADHNYRQAITSAGTGCMAALDAERYLDAQ

    >gi|145299424|ref|YP_001142265.1| electron transport complex protein RnfA [Aeromonas salmonicida subsp. salmonicida A449]
    MTEYLLLLVSTVLINNFVLVKFLGLCPFMGVSGKLETAVGMGLATTFVMTLASASSYLMEHYILIPLNIAYLRTLAFILV
    IAVVVQFTEMVIRKSSPTLYRLLGIFLPLITTN
    CAVLGVALLSINERHNFIQSIIYGFGAAAGFSLVLILFAAMRERLVA
    ADVPTPFRGVSIAMVTAGLMSLAFMGFTGLIKI

    >gi|145299429|ref|YP_001142270.1| electron transport complex protein rnfE [Aeromonas salmonicida subsp. salmonicida A449]
    MLQGLWKNNPSLVQVLGLCPTLAVSSTFTNALGLGLATMAVLVSSNLAISLVRNLVPKDIRIPIYVMIIAALVTSVQLLM
    NAYTYGLYQALGIFIALIVTN
    CVIIGRAEAYASKNPPLLAALDGFMMGLGFTLVLLVLGGLREIIGMGTLFDGAELLLGD
    WAKSLRIELFHADASLLLAILPPGGFIGLGLMIAGKNAINDWRDRKQAAPLADSSVSVAGVHATQL

    >gi|145299509|ref|YP_001142350.1| peptide methionine sulfoxide reductase [Aeromonas salmonicida subsp. salmonicida A449]
    MEQIISPADALPGRRDAMVIGQQHAVNGHPTQGPWPEEMAVAWFGMGCFWGVERLFWQQPGVYSTAAGYQGGVTQNPTYK
    EVCSGLTGHAETVQVVFDPSVISYAALLKLFWEQHDPAQGMRQGGDVGTQYRSVIFYGDETQQVIAQQSLAAYQQAMMAS
    GDSRAITTRILPLAPFYYAEDYHQQYLEKNPEGYCGLGGIGFCLPPSLNR

    >gi|145299541|ref|YP_001142382.1| iron-sulfur cluster assembly protein IscA [Aeromonas salmonicida subsp. salmonicida A449]
    MAITMTDAAAARVSSFLTNRGKGIGLRLGVKTTGCSGLAYVLEFVDELADEDQVFEQNGVRIIVDAKSLIHLDGTELDFV
    KEGLNEGFQFNNPNAKGECGCGESFSV

    >gi|145299551|ref|YP_001142392.1| rhodanese domain-containing protein [Aeromonas salmonicida subsp. salmonicida A449]
    MQHNPRFLALVEAIRTQVKETDVHQIKRWQDEGRAFHLIDVREESEWARGHLPGAAYLGRGVIERDIETRYPDPQTELYL
    Y
    CGGGFRSILVAENLQKMGYSRIVSVDGGFRGWCDAGYPVES

    >gi|145299558|ref|YP_001142399.1| alkyl hydroperoxide reductase subunit C [Aeromonas salmonicida subsp. salmonicida A449]
    MSTYINTEIKPFNATAYHNGKFVQVSDADLKGKWSVVFFYPADFTFVCPTELGDLADNYAEFKKLGVEIYSVSTDTHFTH
    KAWHDTSDTIQKIQYPMIGDPTGAITRNFRVMIEEAGLADRGTFVIDPQGIIQIVEINADGIGRDALELLRKVKAAQYVA
    SHPGEVCPAKWKEGDATLAPSLDLVGKI

    >gi|145299559|ref|YP_001142400.1| alkyl hydroperoxide reductase subunit F [Aeromonas salmonicida subsp. salmonicida A449]
    MLDTNLKQQLNTYLQYIVNPIEISVSGNDSDKSAELLALAREISEMSPKIAMTDGSNARKPSMSVAPQGQAPRVHFAGIP
    MGHEFTSLVLALLQSGGHPSKTDPAVLEQIKQLKGEFHFETYISLS
    CHNCPDVVQALNLMATLNPGITHTMIDGALFQDE
    VNERQIMAVPNVYMNGQPFSQGRISLEEIIAKLDTGAADRKAAELSEKAPYDVLVVGGGPAGAAAAIYAARKGIRTAIVA
    ERFGGQVMDTVGIENFISVPYTEGPKLAASLEQHVKQYGVEVITEQRAAAISKDGYVNVELASGATLKSRAVILATGARW
    RDLNVPGELEYRTKGVAY
    CPHCDGPFFKGKRVAVIGGGNSGIEAAIDLAGIVEHVTVVEFADTLRADEVLQKKARSMGNI
    DIIMSARTTEVIGDGSKVVGMDYEDRTTGEIKHLGVAGIFVQIGLVPNTEFLKGSEVALTRFGEIEIDTKGATSLPGVYA
    AGDATTVPFKQIIISMGAGATAALGAFDYLIRNAAPEAAETSAKADAVTA

    >gi|145299607|ref|YP_001142448.1| arsenate reductase [Aeromonas salmonicida subsp. salmonicida A449]
    MSETQIYHNPRCSKSRETLALLEQHGIAPDVVLYLEQAPSEDVIRTLLTQLGFADPRQLIRTKEDLYKELGLADQSGDAL
    IRAMHQHPKLIERPIVIKDGKARIGRPPEQVLEILK

    >gi|145299608|ref|YP_001142449.1| thioredoxin related protein [Aeromonas salmonicida subsp. salmonicida A449]
    MVRVSGRAQEMKRICWMIVAALLTACSPAPEFSNGQGQPVTLAQFAGKPLLVNYFAPWCVPCLRELPLLETLAQEGKIAV
    VVISYDPATPAELGALASRHHIRVPLLIADKEAHLPFSLPTGLPTSYLLDGEGRLQATLVGELDGQKIAALKLRAAQFR

    >gi|145299668|ref|YP_001142509.1| selenoprotein W-related [Aeromonas salmonicida subsp. salmonicida A449]
    MTDVQSPISKPRIEIRYCTLCRWMLRAAWLAQELLSTFDSDLGEVALVPASKGEFRILVNGVLVWDRVADEGFPEAKEIK
    QRVRDIIAPQRDLGHSDRKPAGE

    >gi|145299679|ref|YP_001142520.1| molybdopterin biosynthesis protein B [Aeromonas salmonicida subsp. salmonicida A449]
    MSDILSDAELLRYNRQIVLKSFDFEGQEALKQARVLVIGAGGLGCAASQYLAVAGVGQLTLVDFDKVELSNLQRQVLHTD
    ARIGQHKVDSAAEALRALNPWLKVETHASVADEALLDALLPSHQLVLDCTDNLTIRNLLNQYARKHRVPLVSGAAIRLEG
    QLCSFTWQEDEPCYACLSALFGEQALT
    CVEAGVLAPMVGLVGSLQALEAIKLLAGTGRSYSGRLLMIDGLTGTFREMKLP
    KRPDCPVCSHP

    >gi|145299731|ref|YP_001142572.1| hypothetical protein ASA_2808 [Aeromonas salmonicida subsp. salmonicida A449]
    MRVEVKPDREYAWFIRPFFWLQKRNYGQVLIPGKCWGRSPRLFAAVATLYGVINRKRSPIDPVLRSLVTVRVSQLNWCRF
    CVDINAMTLIKRAGSSDKVEALAHWRTSPLFDEREKAVLDYTEAMTGLDGVSDEQAARLKPWFDDDAMVELTGLVAFQNM
    SAKFNAALDIAPQGFCQLPVQPERPVAAQEQQPGKDA

    >gi|145299732|ref|YP_001142573.1| hypothetical protein ASA_2809 [Aeromonas salmonicida subsp. salmonicida A449]
    MKRARLLLLLVMGCLIGAFFALDLGRYLSLSQLQAHQDALAQLVNTHFVAACLLFVALYVISTALSLPGASLLTLGGSAV
    FGIGWGLLLVSFASTIGATLAFLSARFLLRDWVLRHFGDKLATFQAGMAKDGAAYLLSLRLIPLFPFFLVNLLMGLTPIR
    VSTYYWVSQLGMLPGTFVYVLAGSELATLTSTGNILSPGLMVALTLLGLMPFLMKRAMTWLAQRRLHAPYQKPSRYDYNL
    LVIGAGAGGLVTSYIAAAVKANVALIEKHRMGGD
    CLNTGCVPSKALIRSSRFAAEQRKAGELGFSPSHSRADFAAVMERV
    AQVIKEVEPHDSVARYQNLGVECIEGEAKLVSPWEVEVNGRRLTSRHIVIATGARPLVPNLPGLADTPYLTSDTLWQLRT
    PPRRLLVLGGGPIGCELAQSFALLGIPVTQVELADQLLPREERDVADALQHQMVADGVTLLTGWRAERVDYVPQEGSEQG
    EHLPIRLHLCRGDQRLMVEGDQLLLALGRVANVSGFGLETLGVELAPRGTIAVDGFLATNYPSILAVGDVAGPYQFTHFA
    AHQAWHAAVNALFGQFKRFKADYSVIPAATYTSPEIARVGLNRKEAMAQGIPFEVTRFALGELDRAIADGERHGFIEVLT
    VPGKDKILGATIVGTHAGERLAEFVLAMRHQLGLGKILATIHAYPTLMEGNKYVAGEWKRAHQPTRVLALLARYHHWRRG
    A

    >gi|145299771|ref|YP_001142612.1| alkyl hydroperoxide reductase subunit C [Aeromonas salmonicida subsp. salmonicida A449]
    MVLVGRPAPDFTAAAVLGNGQIVDSFNLASHIKGKAAVLFFYPLDFTFVCPSELIAFDHRYEEFQKRGVEVIGVSIDSQF
    SHNAWRNTKVEDGGIGQVKYPLIADVKHEICKAYDVEHPEAGVAFRGSFLIDSHGMVRHQVVNDLPLGRNIDEMLRMVDA
    LQFHEEHGEVCPAQWEKGKKGMTASADGVAKYLSENAASL

    >gi|145299805|ref|YP_001142646.1| hypothetical protein ASA_2886 [Aeromonas salmonicida subsp. salmonicida A449]
    MFRSQVSAFRAHARRQGLPMATTLYGIKNCDTIKKARKWLDEAGIDYRFHDHRADGLDPAALDSWLEKLGWEALLNSRGT
    TFRALPDEAKQGLDTAKARALLLEHPAMIKRPLLDRDGELTLGFKADHYQSLFSR

    >gi|145299893|ref|YP_001142734.1| hypothetical protein ASA_2985 [Aeromonas salmonicida subsp. salmonicida A449]
    MMFETQWLLALSGGLLVGLSALMLMLFNGRVAGISGILAGALQHRHAWRWLFLLGLGAGAWLAFSLGWARMPSFSALPTW
    PLVALAGLLVGMGTRFGNG
    CTSGHGICGIGRLSVRSLFATLIFMAAGFMTVFVTLHLL

    >gi|145300095|ref|YP_001142936.1| Na(+)-translocating NADH-quinone reductase subunit E [Aeromonas salmonicida subsp. salmonicida A449]
    MEHYLSLLIRSIFIENLALSFFLGMCTFLAVSKKVKTAMGLGIAVIVVQTVAVPANNLIYNYVLKDGVLVSGLDLSFLSF
    ITFIGVIAALVQILEMALDKYFPALYNALGIFLPLITVN
    CAIFGGVSFMVQRDYNFVESVVYGVGSGAGWMLAIVAMAGI
    REKMKYSDVPQGLRGLGITFITAGLMALGFMSFSGISL

    >gi|145300096|ref|YP_001142937.1| Na(+)-translocating NADH-quinone reductase subunit D [Aeromonas salmonicida subsp. salmonicida A449]
    MADKSEMKKLLLTPVLGNNPIALQVLGVCSALAVTSQMKTAFVMTLAVTAVTAFSNLFISLIRNQIPNSVRIIAQMAVIA
    SLVIVVDQVLKAYAYEISKQLSVFVGLIITN
    CIVMGRAEAYAMKSAPLPSFLDGIGNGLGYGAVLLTVATVREILGSGTW
    FGIELLPLVNNGGWYVPNGLLLLPPSAFFIIGLIIWGVRTRDPKQVEAKD

    >gi|145300114|ref|YP_001142955.1| DsbA family, Com1-like subfamily protein [Aeromonas salmonicida subsp. salmonicida A449]
    MRIKHALLCALTGATLLAAPVQASELTKSDVEQIVRDYLVKNPEILVEMSNALRAKQESQQAANDKSLIEAHAKQLYSNK
    DPESGNPKGSLTVVEFFDYN
    CGYCKRAHPLIKQLLGEDKDIRYIYKQFPILSESSYFAARAALAVQLGQPDKYQAFHEKL
    YAHQGPLSDEAQVKQLAEAAGVNWSKVEAKIKDGSIDQNLGTNRALAEAMSISGTPAFIIGDQILRGAPRDLASLKGFIK
    DVRAGKSIQ

    >gi|145300152|ref|YP_001142993.1| methylated-DNA-[protein]-cysteineS-methyltransferase [Aeromonas salmonicida subsp. salmonicida A449]
    MIRYDVLPTDCGELLVAINARGLVHVDFVAGLRALPDMSGWQQDSEALAPYLAEFAAYFAGRLQRFTLPLAAHGTAFQQA
    VWQALCDIPYGETRSYGDIARAIGKPAAVRAVGAANGRNPLSIIVP
    CHRVIGQNGSLTGYAGGLPIKQQLLALECDQSRS
    ANQP

    >gi|145300280|ref|YP_001143121.1| bacterioferritin comigratory protein [Aeromonas salmonicida subsp. salmonicida A449]
    MQPLSAGTLAPDFSLSDQDGNPVRLSDLRGKKVLIYFYPKAMTPGCTTQACGLRDVNSELAALNVVVLGISPDPAKHLKK
    FEERDSLNFRLLADEDHAVADAFGVWGPKKFMGKEYDGIHRLSFLIDEEGKIAHRFDKFKTSDHHQVVLDLIKG

    >gi|145300376|ref|YP_001143217.1| thiol:disulfide interchange protein DsbD [Aeromonas salmonicida subsp. salmonicida A449]
    MTLSRLLSPLLVLFAMLLSTLSVTPVQASSDSLLSALGIEANAQPKFLKVDDAFALESEQQGNQLLLTLRIADNYYLYRH
    SLRFKGENLTFNEPVLPAGAEHEDDFFGKTWVYYREVQIPVTLTEAGQQASLTVSYQGCTDGLCYPPTDKQIAVQPVVAN
    DTDPAATDDMTRAPASSQQDQLAAALGSQGFWLSIAAFFALGLGLAFTPCVFPMYPILTGIIAGAGHRLSTRRAFLLSFV
    YVQGMAVTYTLLGLVVASAGLKFQAALQHPYVLIGLSVMFVLLALSMFGLYTLQLPSSLQTRLSGLSNRQQGGSVLGVSI
    MGMISGLVCSPCTTAPLSGALIYVAQSGDLWLGGAALYALSLGMGPPLLLLGTSGGKLLPRAGAWMDVIKQLFGFALLAV
    PILLLSRLWSDQVATLAWLGWGLLLCGYLYHHNQHRAHSVGKSLGGFVLLLAMMSLVVVGKDLLLPVPGVKASAETQAPQ
    FIRIKTLDDLKTQLAAARGKPVLLDLYADW
    CVACKEFEHKTFSDPAVRARFDDIALLQADVTANDDADVELLNGLNVLGL
    PTLIFFDSAGQELSDQRVTGFMGPTEFLGQLDKLR

    >gi|145300446|ref|YP_001143287.1| osmotically inducible protein C [Aeromonas salmonicida subsp. salmonicida A449]
    MKTLYRTQAIAQAGRNGEVHTLDNSLQLALALPTALGGNGKGNNPEQLLAAGYAACFSNALIHVAQKLGAPITSAPVTAS
    VELLALADGRFNFAITLDVALAAAQPEQMAQAEQLVRLAHQT
    CPFSNAIRGNVVTRLRLNDIELEEKQ

    >gi|145300672|ref|YP_001143513.1| hypothetical protein ASA_3805 [Aeromonas salmonicida subsp. salmonicida A449]
    MSHVLSTGLASPMDASAFFEAQLRFRTDPADLAADLLEKEERIVVIDTRSAQHYRLGHIPGAVSFPHGSMNQATTATLAR
    DKVYVCY
    CDGIGCNGSTQGAYKLAALGFQVKELIGGLHWWRQDGFAVALGEDAGVLLEGGMTCGY

    >gi|145300763|ref|YP_001143604.1| thiamine biosynthesis adenylyltransferase ThiF [Aeromonas salmonicida subsp. salmonicida A449]
    MLSDAEYLRYGRQLMLSEIGEAGQARLKKASVLIVGLGGLGSPLALYLAGAGVGTLWLADGDVVDSSNLPRQILFDADAV
    NRSKAELARERLAAHNPHVELIAINQRLDEQSLPAFVAEVDLVVDCCDNLASRHAINAVCVAQHKPWISAAAVGWQGQLM
    VRTAPEHACYACLYPLDTRITES
    CQSSGVAGPLVGVMGALQALEALRLLLGKPSPVAGTLRRFDALTHEWQTLGLSPDPA
    CSVCDASTFANPMEDAQ

    >gi|145300951|ref|YP_001143792.1| rhodanese domain-containing protein [Aeromonas salmonicida subsp. salmonicida A449]
    MQEYLDFAARNPLLTAAWFGLAGTLVYTSVRARFSPVKTVNNHTATLLINRENATVVDIRSQEEFAKGHLAGAQHLLLSQ
    IQSNNLGPVEKHKDAPIIVV
    CESGMTAGGAGRQLSKAGFKQVYVLSGGMAQWRADNLPVTKKR

    >gi|145301007|ref|YP_001143848.1| YeeE/YedE family protein [Aeromonas salmonicida subsp. salmonicida A449]
    MNRKWSLPIVVLAGGALLWLGNTFGMKWALMALIGFGFGFTLSFSRFGIVFGWREMLTKRNSYYVRVHLLTIAIEILLFT
    CFLSFSHALFGDAMVGNVMAIGIPFIVGAFLFGIGMQLAGV
    CATGTLYCCGEGQPRFWLVLICYGIGTLISNQFRPELEA
    TFSSQVVLAKDLTGNLWSGMLLNLALVAVLFLLFRNSELKRTGELKPLFSGGNLFWRDGRFTVLTGGILIALLNSSVVAL
    HGSAWTITGAVYDMALRGASLFGLFEGNPKLAQPLFINPMVGMFWLGILGAMLARCINGGGNFVPMRLGNSLASILGGLL
    MGMGAMYSA
    CNLGGFFDGTASGSLHGWVWMLIALAGSLIGIRLRPLFKL

    >gi|145301117|ref|YP_001143958.1| thiosulfate sulfurtransferase glpE [Aeromonas salmonicida subsp. salmonicida A449]
    MQMDQFAHISAHDAHQKLAAGEARLVDIRDPQSFETAHAVGAFHLTNGTLVRFMDEVDFDTPVIVICYHGNSSQSAAQYL
    LQQGYDEVYSLDGGFEAWRQEFPIEAGDA

    >gi|145301125|ref|YP_001143966.1| thioredoxin [Aeromonas salmonicida subsp. salmonicida A449]
    MSDKIVQLSDASFEADVIKADGAVLVDFWAEWCGPCKMIAPILNEVAQEYAGRVTVAKLNIDHNADTPPKYGIRGIPTLL
    LFKNGEVAATKVGALSKTQLKEFLDVNL

    >gi|145301244|ref|YP_001144084.1| DsbA family oxidoreductase [Aeromonas salmonicida subsp. salmonicida A449]
    MYQSVKVDQLTNDLAKVNNTLSNMNAITTNSITFKNQTEFDTAVAASINKLVDKQQQEKMSQKYAQFDAAAEKVADGKHI
    YGDLNARFTLVEFSDIE
    CPYCKRFHDTPKQLVDASKGNVNWQWKHMPLDFHNPAAFKEAVAAECISEQKGNRGFWVFIND
    MFEHTQGNGAGVKDLPQVVAGVGADLSAFRECLAAGKMDEKVQENIQQAKSLGVNGTPATFVVDNKTGKSQLLGGAQPPE
    AIMAAMRKMVVEDQEQSAVKQ

    >gi|145301296|ref|YP_001144136.1| putative mercuric transport protein [Aeromonas salmonicida subsp. salmonicida A449]
    MSTEVRLRYPIQIQKGQRMSEPQNGRGALFAGGLAAILASTCCLGPLVLVALGFSGAWIGNLTVLEPYRPLFIGAALVAL
    FFAWKRIYRPVQACKPGEVCAIPQVRATYKLIFWIVAVLVLVALGFPYVVPFFY

    >gi|145301297|ref|YP_001144137.1| mercuric transport protein periplasmic component [Aeromonas salmonicida subsp. salmonicida A449]
    MKKLFASLALAAAVAPVWAATQTVTLAVPGMTCAACPITVKKALSKVEGVSKVDVGFEKREAVVTFDDTKASVQKLTKAT
    ADAGYPSSVKQ

    >gi|145301299|ref|YP_001144139.1| putative mercuric reductase [Aeromonas salmonicida subsp. salmonicida A449]
    MSTLKITGMTCDSCAVHVKDALEKVPGVQSADVSYAKGSAKLAIEVGTSPDALTAAVAGLGYRATLADAPSVSTPGGLLD
    KMRDLLGRNDKTGSSGALHIAVIGSGGAAMAAALKAVEQGARVTLIERGTIGGT
    CVNVGCVPSKIMIRAAHIAHLRRESP
    FDGGIAATTPTIQRTALLAQQQARVDELRHAKYEGILEGNPAITVLHGSARFKDNRNLIVQLNDGGERVVAFDRCLIATG
    ASPAVPPIPGLKDTPYWTSTEALVSETIPKRLAVIGSSVVALELAQAFARLGAKVTILARSTLFFREDPAIGEAVTAAFR
    MEGIEVREHTQASQVAYINGEGDGEFVLTTAHGELRADKLLVATGRAPNTRKLALDATGVTLTPQGAIVIDPGMRTSVEH
    IYAAGDCTDQPQFVYVAAAAGTRAAINMTGGDAALNLTAMPAVVFTDPQVATVGYSEAEAHHDGIKTDSRTLTLDNVPRA
    LANFDTRGFIKLVVEEGSGRLIGVQAVAPEAGELIQTAALAIRNRMTVQELADQLFPYLTMVEGLKLAAQTFNKDVKQLS
    C
    CAG