Acetohalobium arabaticum DSM 5501 uid51423

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|302390806|ref|YP_003826626.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Acetohalobium arabaticum DSM 5501]
    MKKVQKELILTLFLVGILLLVGCTQTELREKASDVPIKPKVDFKAPDFTLTDLNGKKVKLSDFKGQVVFLNFWATWCPPC
    RAEMPHIQEIHQEKGNKVKVLAVNVKESPKKVKEFMEKNGYNFTVLMDKTGEVANDYLVRGIPKTLIINQERVITTEHVG
    SMNKTKMNNLLTEAF

    >gi|302391157|ref|YP_003826977.1| RnfA-Nqr electron transport subunit [Acetohalobium arabaticum DSM 5501]
    MNLLKKLYYKIKYTRVFALLYKGIWQENDLLIASLGICSALAVTNRVANGIAMGLAVTFVILASSVLTATIRDYIPKRVR
    IVTYVIFISTFVVIVDQFLKAFFPAISRALGAYVGLIITN
    CLIMGRAESFASNNPVDSSIVDAFAHGMGYTIVLIIVSAV
    REVLAFGTILQIPVVGEAWTNWVVMAMAPGGFFVLAALTWVVREIQIYEEEEESPNSRAELDASEKVLSV

    >gi|302391158|ref|YP_003826978.1| RnfA-Nqr electron transport subunit [Acetohalobium arabaticum DSM 5501]
    MPESLSIFIAAITSHNLALTYILGMCPMLGVSKNLDTAVGMGISVAFVVVVTSMVNWGIYNLILVPTGTEILNYVVFIVV
    IGASVQLLEMILEKFLPALYRAFGIFLPLITVN
    CVVLSISLFMTLRNYDFITTLVFALGSAIGWLIAIAIVAAIREKLKL
    TGDVPRGLQGPGIVMIILGIVALAFMGFGGMVSV

    >gi|302391324|ref|YP_003827144.1| electron transport complex, RnfABCDGE type, E subunit [Acetohalobium arabaticum DSM 5501]
    MAELIKDFTRGLWAENPVWVLLLGMCPTLAVTTTAVNGFAMGLATSFVLLGGGIVNSLLRNIIPDKVRIPSYIVVIATFV
    TIADYVMAAYVPNIHSFLGLFIPLIVCN
    CLILGRSEAFAGKNPVHRSAIDALGMGVGFTWALTLLGIIREVFGFGSVFGI
    QIFGDWFTPWIIMVLPGGAFITLGLVLGLFNLIKSK

    >gi|302391325|ref|YP_003827145.1| electron transport complex, RnfABCDGE type, A subunit [Acetohalobium arabaticum DSM 5501]
    MELLLLFVGAAITNNFILARFLGICPFIGVSKEVPTAFSMGMATTFVLTTSAMVVWAVQNLILVPFHLEFMQYVSFILII
    ASFVQLTEMAIRKISEPLYKTLGIFLPLITTN
    CAILGMALLIPLKGYSFIESTVFGFGAGAGFTLAMVLMAGMRENLEFA
    DVPEPLQGAPITLIIAGLMAIAFMGFSGMLSM

    >gi|302391427|ref|YP_003827247.1| dihydrolipoamide dehydrogenase [Acetohalobium arabaticum DSM 5501]
    MLIKLDPEQLPEDADQAKITEICVQPGENIKPETVIMQLEADKTSISLTSKKSGTIKKILVTEDEEIEVQQPLVKIASKP
    IPIKLSTEQLPNDTEEAQVTNLPLKTGDKVTAGEVICELEADKTTITLESKQSGTIAEIKIAEEDTVQTGETLLTITPAQ
    QETKDKQDIKSTSSSETETEITVIGGGPGGYVAALKAAKLGADVTLIEKEKLGGT
    CLNWGCIPTKALVRSAQVYTNLKEA
    EEFGCQAENIDFNWESILERKENIVTKLTQGIEQLLTTHEIKVISGTAQLKDETTVEVTTADEEVIVNTEQMIIATGSQP
    VQLPIIDDKAVDHLLYSRQALDLDELPEKMVIIGGGVIGLEFAFIFSRLDVEVTVIEYLDEVLSFLDSDITEEITQAAQT
    EGIDIYTSAQAKQITSTADDQCLVKFEYQNSEQYITADRALMAVGRKPDLGGLEVEKLGIELDKETDGIQVNDRMQTTID
    NIYAIGDVTGKTQLAHAASHQGIVAVKNIMDQPEKMDYNTIPTAIFTKPEIASVGMTEKEAAKADHTVKIGKFPVAANGK
    ALTLGETTGFVKIIADAKTDQVLGGAIIGPHATDLIAEITLAVNNQLTTEEVIETIHAHPTSAETIHEAALAVRPEGALH
    YDE

    >gi|302391428|ref|YP_003827248.1| OsmC family protein [Acetohalobium arabaticum DSM 5501]
    MSEETFTATVNLLEGVTVEAESRGHKIIMDEPEKMGGTDEGMNPVELTLCSLGGCLSICASMFAKSCDVELNDFSVELEG
    DIDLSGFKGADNVDPGFQDVRFTLYIDSDSPEENIKELVELIENR
    CPVSDSLQRNITIAGDYEIK

    >gi|302391665|ref|YP_003827485.1| hypothetical protein Acear_0886 [Acetohalobium arabaticum DSM 5501]
    MNNRKGIIFTGAVIGVLAGLLVKFGNPVNMGICVACFIRDIAGGMGLHRAGVVQYIRPEIIGFILGAFIISLVTKEFDAK
    GGSSPFMRFVLAMFVMIGALVFLGCPLRMVLRLAGGDLNAIIGILGFAAGIIIGAQFIKKGFTLGRAYQQNQTNGYILPI
    VALILLVFVITKPSFILFSSKGPGAMYAPIMISLLAGLIIGGLAQRSRICMVGGIRDLYLIKDPHLIIGFISVFVFTLLV
    NLGFGNFQLGFVGQPAAHTDGLWNFLGMLLTGFGSVLLGG
    CPLRQTILAGEGNIDSAITFMGYLFGAAIAHNFGLAATPK
    GVSINGKIAVIVGIIIVAGIGFSKAKNFTLTKGGISHGQ

    >gi|302391756|ref|YP_003827576.1| anaerobic carbon-monoxide dehydrogenase diaphorase component flavoprotein [Acetohalobium arabaticum DSM 5501]
    MKSLEQLNRLQQKAQQDLERVEKRILICGGTGCVSSGSKEIQDELRKELEVNNLKSEVKIVETGCHGFCEKGPIIIIYPE
    EVFYCEVDPEDIKELVEKQLLEGEVVDRLLYEDPVSKESIPSYREIDFYNEQQQIALTNCGQINPEDIEEYLAVGGYQAL
    GEALTGMKPEEVIDEVKESGLRGRGGGGFPTGLKWQFAQESEGDKKYIICNADEGDPGAFMDRSILEGDPHKVLEGMIIA
    GYAVGSDEGYIYVRAEYPLAVKRLREAISQAREYGLLGENLFGTEFSFDINIKEGAGAFVCGEETALIASIEGRRGMPQS
    RPPYPAQEGLWGKPTNINNVETYANISTIITEGAESFSSVGTEESKGTKVFALAGKINNTGLVEVPMGITVEEIIYDIGG
    GIPGDKDFKAVQIGGPSGGCLPEEKLHLPIDYDSLLEAGAMMGSGGLVVMDEDTCMVDVARYFLDFTVSESCGKCAPCSE
    GTKRMLDILERITDGNGKQEDLEQLEKLAEVIKDTSL
    CGLGQTAPNPVLSTLKYFRDEYKAHVKDNKCPAGVCKSLVEYQ
    ITDDCQGCTKCVDECPGDAISGEAKEQHTIDEDDCIKCGSCINVCPFDAIVTK

    >gi|302391763|ref|YP_003827583.1| selenoprotein B, glycine/betaine/sarcosine/D-proline reductase family [Acetohalobium arabaticum DSM 5501]
    MSLRIVHYINQFFGQIGGEEKADIPPKTEEGPVGPGNGINAGLKEIGEIVKTIICGDDYFNEHTEDAKVEIKKVLEDVEP
    DLVLAGPAFNAGRYGMACGGVAELACDELDIPVISAMYPENPGYEMYKNYAYVIKTSDSAAGMREAIPNLIKLIKSYNKK
    DGKLGRPEEEGYMTRNLRKNIFAEKRGSTRAVEMLVKKINGEEFETEYPMPDFDRVDPVDPIEDLANTKVALVTSGGIVP
    EGNPDRIESSSASKYGEYKITETGETAHGGYDPVYANEDPNRVLPVDVMRDLENEGAIGELHEFYYSTVGNGTAVANAKA
    YAEEIAEKLINDGVQAVILTST
    CGTCTRCGATMVKEIEKAGLPVIHVATVVPISKTVGANRIVPAAAIPHPLGDPEKSLE
    EEKQIRREIVDKCLQALQTEIDDQTVFSYVKGC

    >gi|302391830|ref|YP_003827650.1| selenoprotein B, glycine/betaine/sarcosine/D-proline reductase family [Acetohalobium arabaticum DSM 5501]
    MSQKFKVVYYLNQFFGQVGGEDEADIEPFTEEGPVGPAQGFEGMLEDGEVAGTVICGDNYFNENSEAVDTVLEMINEYDP
    DVVVAGPAFNAGRYGMACAGVCKAVAEELGISVVTGMYEENPGLDVCKEIAYVVETADSAAGMRDALPTMANIVDKLVSG
    KPLGPPEEEGYIPQGRRKTVFSDKRGSLRAVEMLMARLNGEEFETELSMPEFDDVDPADPVEDITEATVALVTSGGIVPG
    DNPDQIESASATKFGCYSIEGVNDLKEDTDYITIHGGYDPVYANEDCNRVVPLDVLRDLEEEGAVGNIHDKYYVTTGTGT
    AVANAEEFGEEIGEELKNDGVDAVILTST
    CGTCTRCGATMVKEIERYGIPIVHMASIISISQSVGANRIVPSIAIPHPVG
    NPDLGLKEEKELRKSMVEKALEALTTEIEDQTIFE

    >gi|302391831|ref|YP_003827651.1| glycine reductase complex selenoprotein A [Acetohalobium arabaticum DSM 5501]
    MLEGKKVAIIGDRDGIPAPAIQECIETTGAEVVFGSTECFVCTAAGAMDLENQKRIQELAEEHGEENLVVILGGAEAEAS
    GLAAETVTNGDPTFAGPLAGVQLGLRVYHVVEPEIKDEIDEDVYEDQISMMEMVLEVDDIVEEVKKYREEYCQFI

    >gi|302391832|ref|YP_003827652.1| thioredoxin reductase [Acetohalobium arabaticum DSM 5501]
    MSKEYDVIIVGGGPAGLSAGMYASRSKLDTLLLETGDVGGQPKSYEEMENYPGVLDASAPELVENFKEHAQEFGTEIKEG
    EVKEIDADGFVKTVTTKEGVEYKAKSIILATGAEPRRLDVEGEEEFKGKGVSY
    CATCDADFFVDLEVAVVGNGNSAIEEA
    LYLTKFASKVTVIVIHEEGTMDADKIYQERAYENDKIEFVWNSTVDRIEGDGLVDKAVLKNIKTGDLTDFECDGIFIFIG
    RVPSTDFVEDTVELTDNGYIKVDDTLETSKPGVFAAGDVREKYLRQVVTAAADGATTATAAGGYIEEEEYWQENVLEADE
    DVLVAFWSPTNEESMDMTNKLENMDLDAKLVKIDTYKNMRISNRYEVTEIPTLLKLQDGEVVEKLIQPTVDELEEII

    >gi|302391833|ref|YP_003827653.1| Thioredoxin domain protein [Acetohalobium arabaticum DSM 5501]
    MIEVDKENYEEEVLEVEGPVMVDYWGEGCDHCLELMPGVEDLAEKYGDDMKFCKLNIKGNRRLAMSQQVMGLPSMVFYVD
    GEKVEHLSGDDLTIEEIEEEIKKHI

    >gi|302391874|ref|YP_003827694.1| heavy metal translocating P-type ATPase [Acetohalobium arabaticum DSM 5501]
    MANTYKAVAGLKKEFLLQGLGCANCASKMEHRINELDNVKTAELNFTVQKLIITVEDESELDETIEAAEEIIHDLEPEVE
    VKEAEEEKDSESIMDNAEIKRKGLRITVGSFFFIAALIAPVSFNFKLVLFITAYLTIGGGVLKRAVRNISKGQFFDENFL
    MALATTGAFAIQEFPEAVSVMLFYQLGELLQNIAVDRSRRSIKDLMDIKAEYANLKTETGVKEVDPAEVNIGDRIIIKPG
    ERVPLDGKVISGEAQMDTSALTGESAPRKVESGEDILSGFINKTGVLTVEVKKELQESMITRILDLVENASAKKAPTEKF
    ITKFARYYTPAVVFVALALATLPPLLLTDALFADWIYRALVFLVISCPCALLISIPLGFFGGIGAASKRGILVKGGNYLE
    ALNNLDRVIFDKTGTLTEGNFEVDEVIAAKGYTKQEVLDLAAKVEVHSNHPIAQSILAASSKDINAEDIEGYEELSGQGI
    KAKIAGEEVLVGNEKLLSKLALESNRYKSEDKTVVNVVVEEDYIGSILIADQIKSDAKEAIAELKELGIKEVVMLTGDNK
    IVAERIVDKLGLDSYQAELLPNEKVKKTERLLAQSSNDGKLAFVGDGINDAPVLARADVGVAMGGLGSDAAIEAADIVLM
    TDEPAKLGEALEVASDTKRIVWQNIILTLGIKGIVMALGAVGMATMWEAVFADVGVALLAVLNSLRIIKSKK

    >gi|302391883|ref|YP_003827703.1| thioredoxin [Acetohalobium arabaticum DSM 5501]
    MVEESTVKLTEENFKNEVMKSDKKVLVDFWAPWCGPCKQVSPIVEELGEEHEEVKIGKVNVDENQNLAAEYGIMSIPTLI
    VFEDGEILNKQVGAASKERLESLIK

    >gi|302392010|ref|YP_003827830.1| methionine-R-sulfoxide reductase [Acetohalobium arabaticum DSM 5501]
    MKDNKIEKSKAEWEKILTDDEYRVLREQGTEPAFDNEFYDNFKDGIYLCAGCGNELFSAEDKFKSGTGWPSYTKPIDEEA
    VETSIDKSLLQTRVEVHCNRCGGHLGHIFEDGPEPTGLRY
    CINSTALNFKEEK

    >gi|302392081|ref|YP_003827901.1| protein of unknown function DUF255 [Acetohalobium arabaticum DSM 5501]
    MTTEQKGDPNRLIEEQSPYLLQHAYNPVDWYSWSDEAFKKAKTEDKPVFLSIGYSTCHWCHVMERESFEDEEVAEILNRS
    FVAIKVDREERPDIDNIYMTVCQTLTGRGGWPLTVIMTPEKKPFFAGTYFPKEAGRGQPGLMDILIRVEQAWKKKRQPLL
    ETSEEILSALERVNDTDKNDSASMEEMSGLAKEAFISFVANFDEDYGGFGTAPKFPTPHNLMFLLRYWKSTGEEKALEMV
    ETTLDNMYRGGMYDHLGYGFARYSTDEKWLVPHFEKMLYDNALLAVTYLEAYQITDKEDYADIAREIFTYVLRDLTSPEG
    GFYSAEDADSEREEGKFYVWTPNEIKKILGNKQGEEFCQVYNITDEGNFEGKSIPNLIGTELDKSEVDKKFAAERKELFK
    AREKRVHPHKDDKILTSWNGLMIAALAIGARVLNDERYQQAAKEAAEFIWQNLRRDGNGRLLARYRNGEADYYGYVDDYA
    FFIWGLIELYETTFETEYLEKAAELNNDLIEYFWDKEQGGLYFYGYDSEELLTRPKEIYDGAIPSGNSVATLNLLRLAKL
    IGDTELEEKARQQFEYFGSRITNKPIASSYFLLSWLFAQNGGREIVIAGNREETVTEEMVQVLHQEFLPFTVSLLNTTQE
    RKKLSELVPFAADQMKVDKRPTAYICENFACQKPVIDIEQFKERLQ

    >gi|302392537|ref|YP_003828357.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Acetohalobium arabaticum DSM 5501]
    MDDIEKFDIVVIGGGPAGLSAAINAKIRNKEVAIFENQQLGGKIWDAPHVDNYLGFYDIDGQELVNKFIDHINKLEIPVI
    KKKVIRTLSMGEYFSITTNQENYEADKIILATGVNNPNRIDGETEFLGQGVSY
    CATCDGKLFRGKKVAVLGYAEDSVEET
    NYLAELAETTYFIPEDDLDYEELASEVEIIESEPEEIKGDGFVDELVLEDRSLEVAGVMILRPTVPTDEIIDGLDLEDNY
    IKVDSNFETSVEGVYAAGDCVGKPLQLPKAVGEGQVAILNAVE

    >gi|302392659|ref|YP_003828479.1| Peroxiredoxin [Acetohalobium arabaticum DSM 5501]
    MANQQQNDTPRACLPQIGAEAPGFTAMTTFGERSLSDYRGNWLVFFAHPGDFTPVCTTEFIAFAEAYDKFQERGAELLGL
    SIGSIPSHLAWVYDIYEETGVEIPFPIIADVNQQIAKLYGMISEEASTTTTVRPVFIIDPQGIVRLILYYPLEVGRSIPE
    ILRTLDALQTADRKNAATPANWQPGDPLVLPVPKTYQELLDRVENRPGYDCIDWYLCYMDYNNR

    >gi|302392697|ref|YP_003828517.1| heavy metal translocating P-type ATPase [Acetohalobium arabaticum DSM 5501]
    MEQAQQLERSTLKIADMTCASCAQRVESALDNTEGVIDATVNFAAEKATVEFNPAQVSDYDLKQIVEDTGYEVVEEEKTE
    VEEQDEDQQKIAKARSKMLWSWGLTIPIILWMIPEMFLGIAWPTETVYHLGMIALATPILLLVGRKTYYTAYKAISHGSA
    NMDVLIAMGTGAAFITGPASFFTPLADYAGVAGMIMTFHLTGRYIETKAKGRASQAIKKLLELGAKTATVVREGEEVEVP
    VDEVQVGDIMVIKPGEKVPTDGEIIEGESAIDESMATGESMPVKKTVGDEVIGATINQRGLIKVKATKVGKDTFLSQVIK
    MVEEAQGTKVPIQEFADRVTSIFVPTVLIIAAVTFGLWLLFPETLREVTTWAAAYLPWVNPNLGLITGAIFATIAVLVIA
    CPCALGLATPTALMVGTGMGAENGVLIRKGEAIQTLKEVHTIVFDKTGTITEGHPAVTDLVPSEGFSEAELLQLAASVEA
    GSEHPLGEAIVRRAQEDDLTIDDISGFEAITGKGVQAQVGDSQVFVGSRRLMDEQDIDVSPVEDRMKTLEEEAKTAMLIG
    VDNQLAGIIAVADPLKEDSKQAIAELRDLGLETAMITGDNERTAKAIAQEVGIDHVVAEVLPDGKVDEIMKLQDEFGTVA
    MVGDGINDAPALTQANVGIAIGTGTDIAIESSDVTLVRGNLSSVITAIKLSRATFRKIKQNLFWAFIYNTIAIPVAILGL
    LHPIIAEAAMATSSISVVTNANLLRRVDVQPRYLEK

    >gi|302392745|ref|YP_003828565.1| protein of unknown function DUF395 YeeE/YedE [Acetohalobium arabaticum DSM 5501]
    MSNWSPYLVGAGIGILSWLTFLLSNKTIGVSTAFVRTAGIIEKFFRGDKALERKYYEEYPPVIDWGWTFVLGIAIGAFIS
    VQLSGDFRLVSIPAFWNQQFGSSKLFRWILAGIGGIFIGFGARWAGG
    CTSGHGISGTLQLAVISWITFIFFFIGGVASAF
    ILYSF

    >gi|302392760|ref|YP_003828580.1| redox-active disulfide protein 2 [Acetohalobium arabaticum DSM 5501]
    MEIKVYGPGCKNCVKLADNAKAAAEDLGADAEVEKVEDMSEIAQAGIMSTPGLGINGEVKVKGRVPNVEEIKELIEAEM

    >gi|302392775|ref|YP_003828595.1| Methyltransferase type 11 [Acetohalobium arabaticum DSM 5501]
    MNDSKNDIKEKVRENYSQIVEGENKGCCSSSGCCSGNSEGIDIAQISNKLGYTSEDLETDFIEANQGLGCGNPQAITNLQ
    PGQTVLDLGCGAGFDVFLAAREVGIEGKVIGVDMTSEMITKARKTAEENNFENVEFRLGEIEALPAADNSVDVVISNCVI
    NLSVDKEAVFQEIYRVLKSGGRIAISDVVKNNELSEEIKDNLENYSR
    CITGAIPAEELEEIMEKNGFEDVEIKRKENSEE
    IVQDWSTEIQPEDFIYSAYITGKKPE

    >gi|302392785|ref|YP_003828605.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Acetohalobium arabaticum DSM 5501]
    MGNKVLIVGGVAGGASTAARLRRMDEEAEIIIFEQGPHISFANCGLPYHIGKVIEEREKLLVQTPEAMEARFNVEVRIKN
    KVVKIDRANQELEVKDLESDETYREDYDYVVLSPGADPIKPPVPGVDGDRIFTLRNIPDTDEIKGYVDQHKPDSAVVVGG
    GYIGVEMAENLHERGLDVSIVELAPQVLGPLDREMAAQVHNHLRMKGIELYLDNGVAGLADQEDKKKVSLSNGEELTTDL
    VIMAAGVSPNTELAQKAGLEIGETGGIKVNDYLQTSDPNIYAIGDAIEVTDAVTSNPAYIPLAGPANKQGRIVANNLTGA
    KEKFPGSQGTAIAKVFDLTVAGTGNNEKQLTEADIDYEVSYINKKNHAGYYPGAVPMTLKILFTPDEGRLLGAQIVGYEG
    VDKRIDVLATAIRFEKTVFDLQDLDLAYAPPFGSAKDPVNMAGFAAGNILNDKVDVIHWHQIDELADDAILLDVREEVEV
    KLGQIDGSVNIPLNSLRDRLEELDKSKEVVVY
    CAVGLRGYIGARILMQHGFENVKNLAGGYKLYSAVQKDEQGIIDDSTT
    PEGERLTSISNPEEGQQAEEEIEKTTSEL

    >gi|302393000|ref|YP_003828820.1| Thioredoxin domain protein [Acetohalobium arabaticum DSM 5501]
    MIEVDKENYEEEVLEVEGPVMVDYWGEGCDHCLELMPGVEDLAEKYGDDMKFCKLNIKGNRRLAMSQQVMGLPSMVFYVD
    GEKVEHLSGDDLTIEEIEEEIKQHI

    >gi|302393001|ref|YP_003828821.1| thioredoxin reductase [Acetohalobium arabaticum DSM 5501]
    MNKEYDVLIIGGGPAGLSAGMYASRSKLDTLLLETGDVGGQPKSYEEMENYPGVLDASAPELMDNFKEHAEKFGTEIKEG
    EVKEIDADGFVKTVTTKEGVEYKAKSIILATGAEPRRLGVEGEEEFKGKGVSY
    CATCDADFFVDLEVAVVGNGNSAIEEA
    LYLTKFASKVTVIVIHEEGTMDADKIYQERAYENDKIEFVWNSTVDRIEGDGLVDKAVLKNIKTGDLTDFECDGIFIFIG
    RVPSTDFVEDTVELTDNGYIKVDDTLETSKPGVFAAGDVREKYLRQVVTAAADGATTATAAGGYIEEEEYWQENVLEADE
    DVLVAFWSPTNEESMDMTNKLENMDLDAKLVKIDTYKNMRISNRYEVTEIPTLLKLQDGEVVEKLIQPTVDELEEII

    >gi|302393003|ref|YP_003828823.1| selenoprotein B, glycine/betaine/sarcosine/D-proline reductase family [Acetohalobium arabaticum DSM 5501]
    MSKKAVHYINQFFGQIGGEEEADYPPSIEEGTVGPANLLDNLLDAEVTHTVICGDNYMGSNEEDAVETILEALEDIDFDI
    FIAGPAFQAGRYGSACGTIGKAVKERFEVPVITCMNEENPGVDMFKKDLHIFPGGASAAKMRDDMKKVADFGNKILNGEE
    LLSAEEEGYFLRGKRHQVWLEDETPAAERAVDMLLKKLNGEEFETELPMPENMGVEIADPIEDLSEAKVALVTSGGIVPV
    GNPDNIQSASATRWGKYDISDLDEFPSREEEEGYRTIHAGYDPAAADAVPDRVVPLDAMRKYEEEDRIGKLHGYFYTTVG
    TGTTEAEASRMGAEIAEELLEADVQAVILTST
    CGTCTRCGATIYKEIEKTGITIVQMANLIPVAESVGANRMVPTISIPY
    PLGDPADSEDDQWKLRYHRVGVALDALETDIEDQTVFNVEI

    >gi|302393005|ref|YP_003828825.1| glycine reductase complex selenoprotein A [Acetohalobium arabaticum DSM 5501]
    MLEGKKVAIIGDRDGIPAPAIQECIETTGAEVVFGSTECFVCTAAGAMDLENQKRIQELAEEHGEENLVVILGGAEAEAS
    GLAAETVTNGDPTFAGPLAGVQLGLKVYHVVEPEIKEEIDEDVYEDQISMMEMVLEVDDIVEEVKKYREEYCKFLDN

    >gi|302393006|ref|YP_003828826.1| thioredoxin reductase [Acetohalobium arabaticum DSM 5501]
    MSKIYDVLIVGGGPAGLAAGLYASRSKLDTLLLETNSQVGGQVSTYHEMENYPGALDTSAPELMENFREHAEEFGTEIKQ
    AEVEEIKPDGFIKTVSTKDGTEYKAKSVIVATGAEPRRLGVPGEDEFKGKGVSY
    CATCDADFFVDLEVVVVGNGNSAIEE
    ALYLTKFASKVTVVVIHDEGTMDADKIYQERAYANDKIEFVWNSTLEEAKGDGLVDTAVLKNIKTGEKTDFSCDGIFIFI
    GRVPRTDFLEGTVELTDNGYLKTDDKLETNVPGVYAAGDVREKFLRQVVTAAADGATTATAAGGYIEEEEYWQKNVVEAE
    EDVLVAFWSPTNDESMEMTNKLENMDLEAQGAKLVKIDTYKNTRISNRYDVTEVPTLLKLQDGEVTDKIAQPTESEIEEL
    V

    >gi|302393008|ref|YP_003828828.1| selenoprotein B, glycine/betaine/sarcosine/D-proline reductase family [Acetohalobium arabaticum DSM 5501]
    MKKAILYLNQFFGQIGGEDKADFAPVIKEGQVGAGMLLNNLLEDAEVSHTVICGDNFMGSNEEEAVDTILGFLEDKDFDI
    FFAGPAFQAGRYGNACGVICKAVKEKFGVPVISSMNEENPGVDMFKKDVDILPGGQSAAKMKDDMTKMAELGNKFLAGET
    GLTAEEKGIYIRGKRHQVWLEDETPAADRAMDMLLKKINGEEFKSELPMPKIDKVPIADPIEDLSEATVALATSGGIVPV
    DNPDKIQSASATRWGRYDVSGMDKLENREAGAFKTIHAGYDPAAANEDPNRVLPLDALRAYEKEGKIGKVDDYFYATVGT
    GTAEVEAARMGQEMVEEMQRDGVDAVILTSN
    CGTCTRCGATIVKEIEKAGIPIVQMANLIPVAKTVGANRMVPTISIPYP
    LGDPGTSEEEQWKLRYHRVGVALDALTTDVEEQTVFSVDI

    >gi|302393010|ref|YP_003828830.1| glycine reductase complex selenoprotein A [Acetohalobium arabaticum DSM 5501]
    MLEGKKVAIIGDRDGIPAPAIQECIETTGAEVVFGSTECFVCTAAGAMDLENQKRIQDLAEEHGEENLVVILGGAEAEAS
    GLAAETVTNGDPTFAGPLAGVQLGLRVYHVVEPEIKDEIDEDVYEEQISMMEMVLEVDNIVDEVKKYREEYCKFLDN

    >gi|302393019|ref|YP_003828839.1| Rhodanese domain protein [Acetohalobium arabaticum DSM 5501]
    MRRKTLLVTILFLVMVLAVSTVTMAGFFDWFTGGSEFKYYSPKKLKQSIEQEKEFLLVDIQPQEDFNNHHIKGAIGTYAY
    PVKSKQDKAKLDRILTQLKKSDDDIVIVCPRGGGGAERTYQYLSSQGIKEKRLYILENGQAGWPYEQLVVDEKLATISTE
    KLATQLGTQDLVVVDVRSDAAYNGWKLKDETRGGHIKGAVHFPVSWLELLENEELIDTLKNKGVTSDRKIVIYGYKDSQS
    KKLGLFLKDELDYKDVAIYKNGIVKWSANNDLPMDKLPNYSKLVSPNWVKDLIDGKDPATYDGRDFVIIDTNYKKFGHYK
    KGHIPTSIYVDTNEIEGPPLWNIVSDAKLKELFKKTGITKDTLVVVYSEEPMAAGRLISVLMYAGVEDVRMLDGGYQAWE
    RAGYSLEKGVNEWQVGGYQVWKKTGHSLKKEIKEWQTGADFGARIPVHPEYYINVPQAKELLKDPNGRLVAVVSWDEYIG
    KNNGGYSYFDEKGRIPGSVWGHGGSDAYHSEHFVDPDWTMRSYPEIEKMWADWDINPENESAFF
    CGTGWRGGLAMFDAYL
    MGWKNISVFDGGWYEWSRNPENPVEFGDPRKE

    >gi|302393027|ref|YP_003828847.1| NADH:ubiquinone oxidoreductase, subunit G, iron-sulfur binding protein [Acetohalobium arabaticum DSM 5501]
    MESVTLTINEQQVTVPADYSILEAAESMDIDIPALCYDSSLEVVGSCRLCVVEIEGSDDLKASCATTVAEGMVVQTESEK
    VVSTRKEILQLLLDNHVNDCLV
    CEQAGECLLQDYAYRYDVKFREHDGETRERIVDTSSPYILRDEAKCILCGKCVRVCEQ
    VSERQVLTFADRGFETKIAADADMTLEESGCVSCNRCVSVCPTGALIDKRNMEKPRSWEVEKEAITCNVCEHGCEFNLLK
    KDGKNIGVEAKAPGEGRPLCLKGRLWTEFENVEEVEEPYLKKDGKFVAVEWKEALELEEVMDKLENSAN