Clostridium acetobutylicum ATCC 824 uid57677

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|15004736|ref|NP_149196.1| rhodanese-like domain-containing protein [Clostridium acetobutylicum ATCC 824]
    MFNIFKNNEIGSISVHDLYERIGKINLIDIREDYEYKDGHIPSAKNVPMGIILKEPEKYIDKSKEYYIVCKSGARSIKTC
    KQLISKGYNVVNISGGTSAYIRPLER

    >gi|15004738|ref|NP_149198.1| rhodanese-like domain-containing protein [Clostridium acetobutylicum ATCC 824]
    MVSTLGSDTFTSISAHDLHGKLGNIHLIDVRENDDFKEGHIPTSRNIPMDILLKEPEKYINKTDEYYIVCQAGVKSEKTC
    KELWSKGYKVINIKDGTDSYKQPLER

    >gi|15004787|ref|NP_149247.1| SAM-dependent methyltransferase [Clostridium acetobutylicum ATCC 824]
    MKWNSNLYDHKHSFVAEYGKSMINFVNVGKDQKILDLGCGTGVLTNELAKNGATVIGTDLSKNMIDKAKTNYPNLIFQVK
    DATNLSFKNEFDTVFSNAVFHWISNQEKLLHSIYTCLKDNGTLICEFGAQNNISQIQTAFEKVIEQKGYSY
    CSPFFFPSK
    EEYKLLLDQAGFEVKHIIEYDRPTPLADGEKGLRNWICQFFASDLLEFSDEQKEQILFETEKLCKNSIWKNNQWVADYRR
    IQIIAVKNKNNGTK

    >gi|15893384|ref|NP_346733.1| methionine sulfoxide reductase A [Clostridium acetobutylicum ATCC 824]
    MKKIIFAGGCFWGVEAYFNTIDGVLNTKVGYANGNTEDPTYEDVCTDSTGYAEACYIEYDEKQLKLEKLIDAYWKVVDPT
    LKNRQGHDEGTQYRTGIYYVDEEDLKVILESKDKEQEKYDAPIVTEILPLKNFYDAEEYHQKYLDKNPNGYCHIPKELLK
    KH

    >gi|15893619|ref|NP_346968.1| hypothetical protein CA_C0327 [Clostridium acetobutylicum ATCC 824]
    MEIREGMKAPDFSLKGSDGKEHKLSDYIGKKVILYFYPKDNTQGCTKEACEFRDSSNKISDLNAVVLGVSKDSIKSHNNF
    IDKFKLPFVLLSDEEEVVCKLYDVIKEKSMYGRKYMGVERSTFIIDENGIVKSIFRKVRVNGHVENIIKSL

    >gi|15894111|ref|NP_347460.1| thioredoxin [Clostridium acetobutylicum ATCC 824]
    MESLQSIKEIRKYIENNELVLMYFRSDNSGICYALDPLIEAISKKYSKISSVKVNTGNLPSVPADFKIFTVPEVIIFMNG
    SIVIEHFKYINFREIEEVLLRYYKCI

    >gi|15894156|ref|NP_347505.1| thioredoxine reductase [Clostridium acetobutylicum ATCC 824]
    MKKEKILDLVIIGAGPAGLTAGIYSSRAKLDFIILENELVGGQIRETPSIENFPGFDSISGADLADKMQEHAEKAGAVID
    EFGNITSVKLTDTEKIIETSDTIYKPKSVIIATGSKSRPLPVPEEKKLRGKGIHY
    CELCDGAMYDGKDIVVVGGGNSAID
    AAIFLTKYAKNLTVVHRSEKLRAEMRSQDELFKHNNVKLLLNTQIKHVEGENSIENIVLENSKTGEKSSLKADAIFVYIG
    TMPKTELFKDFIDLTELGHIKTNENLETNIKGVFAAGDVREKEIRQLTTAVNDGSIASLMAEKYIRNS

    >gi|15894192|ref|NP_347541.1| NAD(FAD)-dependent dehydrogenase [Clostridium acetobutylicum ATCC 824]
    MENHDLVIVGGGISGLQAAISAKKSGVQDIVLIEAEDSLGGILNQCIYTGFGMEDFKEELTGTEYVQRFIDEFLELNIEY
    KLNTTVIKISKNKVITAVSPNEGIIEIKACSIIFAAGAVEKPQKSIRVLTKDLSGIYSALTVGRFINIHGYMPGKSIVIL
    GANKIGNALANRIFIEGGKVKAVIDSEVGFDERNEIIEFLAEINIPFLYNYNIVKIKGSERIEGIYISDENGEKFISCDT
    LILALKLNPNDKILREANIKILNKERNEINTNVPGVFIVGNALYIHESNEGSPLENRKAGEMSAEYIRATL

    >gi|15894825|ref|NP_348174.1| thioredoxin, trx [Clostridium acetobutylicum ATCC 824]
    MIQEINDKSFVNVISNSKKVVVVDFWATWCEPCKMIAPILEEIAGELKESLEIIKINDDKNREAVDKYGISNIPTMLIFK
    NGELQESLTGFNPKNKLKEVFSKYI

    >gi|15894826|ref|NP_348175.1| thioredoxin reductase [Clostridium acetobutylicum ATCC 824]
    MDRYDIAIIGSGPAGLSAAINAVIRNKKVILFGSDNLSNKLLKAPKINNYLGIYDVSGKELKEKFLEHLKYMNIEIKNEK
    VNSVYSMGDYFALSLNQKMYEATSIIIASGVEFSKPLNGEDELLGKGVGY
    CATCDAPLYKGKTVAIVGYTKEAEEEANYV
    SELAGKLYYIPMYKDKVSLKEVIEVVEDKPISILGKDKVSGLQMSKGEINTDAVFIIKDSVSPGKLVPGLLMNGEHIAVD
    IDMKTNIEGCFAAGDCAGRPYQYIKSAGQGQIAALSAVSYIDKIKLNKKII

    >gi|15894827|ref|NP_348176.1| glutathione peroxidase [Clostridium acetobutylicum ATCC 824]
    MSVYDFKAKTIEGKEVSLDTYKGKVLIIANTASKCGFTPQYEGLEKLYKEYKDKGLEILGFPSNQFAEQEPGDNNEVKNF
    CKLNYGVTFQLFEKTDVRDENAHPLFNYLTENAPFKGFDLNHPTGKMLSEVLEKNFPKFLEGNSVKWNFTKFLIDRDGNV
    VKRFEPTSEPSDMVKDIEKLL

    >gi|15894828|ref|NP_348177.1| methionine sulfoxide reductase B [Clostridium acetobutylicum ATCC 824]
    MKKDDLSKKLTPLQYEVTQNNATEPPFNNEYWDNKSEGIYVDIISGKPLFTSLDKFDSGCGWPSFTKPIVKENIKANTDF
    SYNMKRIEIRSKDSDSHLGHVFDDGPKDKGGLRY
    CINSASLKFIPKEALEEEGYGEYLKLFNKKEE

    >gi|15894832|ref|NP_348181.1| heavy metal-binding domain-containing protein [Clostridium acetobutylicum ATCC 824]
    MSIKKDSIKVYDMTCTSCEKKIEKALKTLPGVISVKASFVKQIVTIEYDDTICTIQKIKSEINSAGYRTEAKNIYKIAGF
    ALIALFMVFMSTSTSGFDITSKLKGATYFIIFIVGVLTSIHCVGMCGGILLSQSITKEGNKSSSIKSAILYNSGRVLSYT
    ILGGIVGALGSVFNLSLGLKSFLQIFAAAFMIIMGLNMSGFSLFRKIQLKLPFPRRIFKKAPKTPFFIGMLNGLMPCGPL
    QTMQLYALSTGSPIKGALSLFVFSLGTIPLMMTFGVLSGFISKGSTKVLLKFSGILVMVLGIIMGGRGLALAGVNVPTVS
    SIKNSVLASPSKDTNNSASKAKIVNGVQVIKMTADENGYTPNGLYVEKNKPVKWIIDGKSLNSCNGTIVIPDLNKEITLK
    SGENVIEFTPKGKDISFSCSMGMIRGVIKVVDNVASVDTSKKDSSIPKPSSGMSCCTGGSSASSSSQASSIYGSDISKVP
    TANLVNKANLNGNSQSLTLTGKGYEFQPLISVLNKGVETKLSVDLNGFDNPNGEYSIIDLNTRQTVTTFNGKKGIVEVDF
    KIDTSGSYGIVKDNNMIEALEVVDDLNTSDLEQIRTKYLGR

    >gi|15894848|ref|NP_348197.1| glutathione peroxidase [Clostridium acetobutylicum ATCC 824]
    MSVYDFKAKDISGEEISLSKYEGKVLLIVNTASKCGFTPQYKELEDIYKKLGNEKFEILGFPCNQFANQEPGGSGDIKNF
    CEINYGVTFPLFEKIDVKGENAHPLFKYLASQAGGILGKEIKWNFTKFLIDKKGDVVDRFAPVTKPSKIKDKIVKLMEE

    >gi|15894849|ref|NP_348198.1| glutathione peroxidase [Clostridium acetobutylicum ATCC 824]
    MSIYDFKVKDINGEDISMEEYRGKALLIVNTASKCGFTPQYEDLEALYKKFKGENFEVLGFPCNQFENQEPGTNNDIKKF
    CQINYGVTFKIFDKVDVNGENEAPLYRYLKEQAPFKELDESTPTAKIIAAFLREKLPETLIGDSIKWNFTKFLIDKNGRV
    VNRFESGVEPMEIESYIKALI

    >gi|15895509|ref|NP_348858.1| cation transport P-type ATPase [Clostridium acetobutylicum ATCC 824]
    MESSGIKKQYYVEGIDCANCAAKIEERVRGLNEIEEANLDFVFKKLTFQIKDGSEEKKVFNKVREIVKAVEPDVDLKEVE
    SEQEDEGLKKKDIIRLSMGIVIFALAYILKEQKFGIVLFLISYVLIGGEVILKSIRNIRRGEIFDENFLMTVATVGAFAI
    KEFPEAVSVMLFYEIGEFFQDKAVERSRKSIKSLLNIKAEFANVKNGSELKKVNPEEVRIDDFIVVKPGEKVPLDGVITE
    GVSFFDTSAITGEPVPKSIKPGEEVFSGYINKEGLITVKVKRTFENSAVSKILNLVENASSRKADTEKFITKFAKYYTPI
    VVFSALFIAVLPPLFIKNASFSSWIYKALVFLVVSCPCALVISIPLSFFGGIGAASKKGILVKGGNYLEILNDVSTMVFD
    KTGTLTKGTFSVDKIQAYNGFDEKDVLKLAASVEAFSNHPIAVSIVEAYGQKNDEAEIKEYKEIAGHGIQAYVNGKLVFV
    GNEKLMLKENIDVKEEAFRNDIGTVIYVSCEGSFVGSILISDKLKEDTIKAIEALKRINIKPIMFTGDNKKAALKVSQKI
    GIDDVKYELLPQDKVYNMEKIFEGNMSGRVAFVGDGINDAPVLARADVGISMGSFGSDAAVEASDVVIMTDEPYKIYEAV
    LIAKSTRSIVWQNIVLALGVKAIVLLLTILGISNMWEAVFADVGVALLAVLNSLRILKK

    >gi|15895513|ref|NP_348862.1| stress-induced protein OsmC [Clostridium acetobutylicum ATCC 824]
    MIISESEKENYYTKIFSSNAVIFSDVTKEKGGNGESFGPHDLLCASLASCLNITIRMILEHKNIKYDNVIVKVDLDKSDD
    TKVKFLYNVDILGDISYEIKHRVIDIAKKCPVRRTLSKEIEFEIKENL

    >gi|15896032|ref|NP_349381.1| glutaredoxin [Clostridium acetobutylicum ATCC 824]
    MVKVYSTTSCPWCKKAKSYLASQNIDFIDANVQDDMNARDEMLNLSHQSGVPVINIDGNIVVGFDKDKIDELLNLK

    >gi|15896333|ref|NP_349682.1| thioredoxin reductase [Clostridium acetobutylicum ATCC 824]
    MERYDIAIIGSGPAGLASAINAKTRNKSVIVFGSSDLSKKLTLAPVINNYLGFYGIRGAELQEKFKEHIDNMGIQIENVK
    VNNIYAMGEYFSIMTSKDTYEASKVILAMGMEHTKPLKGEDKFLGRGVGY
    CATCDAPLYKGKIVTIVGYNKEAESEANYL
    AELASKVYYVPRYKDEYQLVSAVEIVKDVPVEIVGDKKVEKLKLKSRELETDGVFVLKDSAPPEQLVPGLYVEDGHIKVN
    RKMETNIDGCYAAGDCTGKPYQYMKAVGEGQVAALNAVEKLYTKA

    >gi|15896334|ref|NP_349683.1| thioredoxin [Clostridium acetobutylicum ATCC 824]
    MVKEINESIFDEEIKTSGEPVIVDFWAPWCGPCKMLGPIIDELSEDLDGKAKFTKVNVDENPGIASKFGIASIPTVMIFK
    DGNPVETLVGFRPKQSITASIEKHM

    >gi|15896506|ref|NP_349855.1| methylated DNA-protein cysteine methyltransferase [Clostridium acetobutylicum ATCC 824]
    MNAKNECAYYKSPIGNLEIKALDEKVSEINFVEAMGEENFQSDVLKAALIQIDEYFRGKRKQFHLRLFIDGTEFQKKVWN
    ELTRISYGEVVSYGEVAKAIGNKNASRAVGGANNKNKIPIIIP
    CHRVIGSDGRLIGYDGGIWRKKWLLEHERKFK

    >gi|15896549|ref|NP_349898.1| thiol peroxidase [Clostridium acetobutylicum ATCC 824]
    MKVKFKGKEVTLEGTEIKVGDTFPDFVAVNSSLEPVMLKNTNRVRVFLAVPSVDTPVCDLEVKTFNARASEIDGVSIYTI
    SMDLPFAQSRWCGAEGIKNVTTLSDYRDRAFGKNTGTYIKELGLLARAVFVVDSSNKVTYANYLEEVSGYPNYDEVLQAA
    QAAK

    >gi|15896688|ref|NP_350037.1| protein-disulfide isomerase DsbC/DsbG [Clostridium acetobutylicum ATCC 824]
    MKIEVWSDFVCPFCYMGKRRLEIALNEFEYKTDVEISFKSFELDPSAKKEYSENIHELIAKKYKISVEQAKASNDQIVLQ
    AEAIGLNYNFNKLIPTNTFDAHRLSQYAKTKGKMNELSEKIFKAYFVDSLNISDYKVLADLAEEVGISRDESLRILESNQ
    YNEEVREDEKNASKLGIDAVPYFVFDDKYAVSGAQPAEVFLEALYKIDKEGKVNDSSSGSCSGGKCDI

    >gi|15896782|ref|NP_350131.1| hypothetical protein CA_C3546 [Clostridium acetobutylicum ATCC 824]
    MSETIHKSSNRLINEKSPYLLQHAHNPVNWYSWSPEAFSKAKSEDKPIFLSIGYSTCHWCHVMERESFEDDDVAEVLNRS
    FVSIKVDREERPDIDEIYMNVCTAITGSGGWPLTIVMTPEQKPFFAGTYIPKNNRMGMQGLISLLENIEYQWKENQNELV
    EIGDKIVSSLNKDRKTTAKELSEEVLEEAFSQFKYNFDRTYGGFGSEPKFPTPHNLIFLMRYFYASKDKTSLNMALKTLD
    TMYRGGIYDHIGYGFSRYSVDKKWLVPHFEKMLYDNALLAYAYTEAFKITKNDNYKNIVDQIFTYILRDMTSNEGGFYCA
    EDADSEGVEGKFYVWSKKEINNVLGEDDGKKFSKYFNVTDTGNFEGENILNLIETEKIEFEDEFLNSCRKKLFDYREKRI
    HPYKDDKILTSWNGLMIAALAFGGRSLKNEIYINAAEKAVTFIFTKLIDANGRLLSRYRHGEASIKGYLTDYSFLIWGLI
    ELYEATYKSEYIEKAIKLNNDLIKYFWDDKNKGLFLYGSDSEELISRPKEIYDGAIPSGNSVSALNFIRLSRLTGSYDLE
    DKCTEILQAFSEEIESYPMGYSFSLLSVLFLGKKSKEITLVSNSYDNTSKEFLEVINDKYNPLSTFIYYIEGDKTLENVS
    NFVSDYQPLNDKPTVYICENFSCNAPVTNISDLKKLL

    >gi|15896887|ref|NP_350236.1| heavy metal-binding domain-containing protein [Clostridium acetobutylicum ATCC 824]
    MGKKISIEGMSCEHCVAHVKEALEGIGAEKIDVNLKRKSAFISNNITDEKIKTAIEDAGYEVTNIEEASEQGGSKLKGLF
    KKITG

    >gi|15896888|ref|NP_350237.1| heavy-metal transporting P-type ATPase [Clostridium acetobutylicum ATCC 824]
    MDTKTLRIEGMTCAACARAVERATKKLEGVEEANVNLATEKLTVSFQDDKVSVPNIQEAIEKAGYKALTEATNKTLAIGG
    MT
    CAACAKTVERVTSKLEGVTSSSVNLATEKLSISFEASKVSINDIKQAIEKAGYKASEEVESVDTDKERKEKVIKNLWK
    RFIISAVFAVPLLIIAMVPMIFNSIGVMLPSAIDPMNNEKIYGVLELILVLPVMFQGRKFFQVGFKTLIKRSPNMDSLVA
    IGSSAAFVYSLFGLYQIFTGINGAQLYFESAGIILTLITLGKYMEAVSKGKTSEAIKKLVGLTPKTALVVKGEKEEEVAI
    EEVKPGDVVIVKPGSKIPVDGIVIEGNTSIDESMLTGESIPVSKGPGDEVIGASINKNGSIKYKVTKVGKDTVLSQIVKL
    VEDAQGSKAPIAKLADIVSGYFVPVVITLAIISSLAWYLSGENLTFTLTIFISVLVIACPCALGLATPTAIMVGTGKGAE
    YGVLIKNGTALENTHKIKTIVFDKTGTITEGKPKVTDIKAIDEVSEEELLKIAASVEKASEHPLGEAIVKEAEFKGMEFL
    KVSDFKSVTGHGIEALIDSKRVLLGNKKLMDNNNIEVKSVLDYVDDLAKQGKTPMYIAIDKQVKGIIAVADSVKESSAKA
    IKKLHDMGIEVAMITGDNKRSADAIAKKVGIDRVLAEVLPEDKASEVKKLQAGGKKVAMVGDGINDAPALAQADIGMAIG
    KGTDIAMESADIVLMKSDLMDVITAIELSKKTIKNIKENLFWAFGYNVIGIPVAMGILYIFGGPLLNPMIAAAAMSLSSV
    SVLTNALRLKRFKPEYML