Clostridiales genomosp BVAB3 UPII9 5 uid46219

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|289449839|ref|YP_003474423.1| AhpC/TSA family antioxidant [Clostridiales genomosp. BVAB3 str. UPII9-5]
    MKLFNGKLNKSLVLVLAGCLAVSSVGCGTAGSEDANKSDKGMQAGKSVDQAMAADSTLIEKSGDGSAKIVQPGAGGSQKI
    KPAEHLMPQLAEYKFPYAGLKLSFPEKINKLIEQKKVALMPREKADKNGDLEYAFLTLSNMTAEQKDAEIELSGDSYDKW
    ADGLERIGSIGFAAASMKEADVKAVAKGDKIKEIGKTEDGKYKYYLVLNSKAPADVTGEFEKTTIGIEKMMPMPQKFGSA
    FVDPADLQAGDKNAISQLNVKTLDGEKFTAAEFGKYDLTLVNVFATW
    CTACVGELPELEKLYQDMKGKGVNVIGLVTDTV
    QGVANDGKVTVDEKALALAKKIREKAKVSFPLLQPDAALFAGYVKGVTSYPETLLVDRNGNVVGDPISGAHSYGDWKKYI
    EAALAKVKGKK

    >gi|289449443|ref|YP_003475863.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme [Clostridiales genomosp. BVAB3 str. UPII9-5]
    MSEGSAAILRVMRVTRVMSVTTKFYLKTGGMIMQDLIIIGAGPAGVSAALYAQSRGLSLTIFEKDRIGGLIGKVSKVSHY
    TSVVVDETGPEFAARLKNQIEAYGLKVIKEEVTGLSKTDAGFTVQTAAASYTAKKVIIATGSTPKELPLNTDGYKIAHWT
    LGTEEK
    CQHKTVIINGGSDGAAKEALHILPFAKAVHMVQNMPQILCIAEFKKQLEADPKLHVHCGTSLASLTKTGSKVTT
    VKLADGTEITDANGIEIFAMIGQTPATSFIKLDLPRNEQGFLADEVKTGIDGLYVAGDVRAKTVRQVATAVNDGCLAGIM
    AAAK

    >gi|289449459|ref|YP_003475857.1| AhpC/TSA family antioxidant [Clostridiales genomosp. BVAB3 str. UPII9-5]
    MKKILALTMSLTLGCLLMSCGGNNTAESGKSTDSTTSAMAAASATGENASSAAATVSSESTETKMTKANETKSNASATGK
    AEVRGPKKDVYKGAETPAAYESETKDGKKVTLDQFKGKVVLLTMGATW
    CPDCQKELKMLNKLYQNYKDNKDVVFLPTYLV
    DGKKETKDTIKAFYEKEKLDLPCYYGDKATLRANFQIGWIPTLMVINKEGKCVPMGKDDAGNIEYYRHTDITPELLTEKI
    SAALEAK

    >gi|289449686|ref|YP_003475856.1| AhpC/TSA family antioxidant [Clostridiales genomosp. BVAB3 str. UPII9-5]
    MVFGYDMKLSGGRFKHSNRLLAAGMSLLLACNLAGCGGNSAAAPSGSAAGAASEAAAASAGSEVAGGTDVFLPPESANSS
    ENGAGGATNPHVKPGQYPGVEVPSDLDLEDDAGNKLKLSDFKGKYVVVSFGTTW
    CPSCKAELGILQKISEKYKDKSNLVF
    LPLTLLKEDKQTKEMAQMFYESEGLTLQRHYVDQKAVVDAYKLTDIPVLMFIKPDGKCMLLGKTADDKPIYYHVGETEAD
    EMAAMVDKLLAAK

    >gi|289449848|ref|YP_003475830.1| YeeE/YedE family protein [Clostridiales genomosp. BVAB3 str. UPII9-5]
    MEKKISLSQTVAGIIIVLALFALGMYVGKLNAKMPMFLLAGFGLGYALTRSRYGFAGGVKRIYIRGEGSLTKAIFVLLII
    TAIIFMGVQWKAQAGGAVPAYLAQQGEKIIPGTQNVYFTNLATIIGGFIFGVGMMLAGGCGSGTLSDFGEGQGRAFIAFI
    FFVLFAAPGHWARQVFDRTAVGKIGYRLHIPQAIGYVPALIITILLIGLMYWGVLRYEAYRKRTGTYKDPKGDYEDFEQP
    LPDTLPRTLFSYATYHKLFVERWSFMVGTFVLAAFAVFVMVTTNKPWGVSSPLVTLDVAILQKLGITFSPENFGGILKKV
    NGGLLADGGTVRNIGTFFGCMVAFLLANRFKVDFNFRFTDACYYAVGGAMLGFGSRFAYG
    CNIGAMYSAITSFSFSGWIF
    LISMALGGVAGMLVFAGKVNILPKLNLRCQIEQNRTQAQKK

    >gi|289450848|ref|YP_003475829.1| pyridine nucleotide-disulfide oxidoreductase [Clostridiales genomosp. BVAB3 str. UPII9-5]
    MGKKVVIIGGVAGGASTAARVRRLDEFAEIKMFEMGPYVSFSNCCIPFHISGTVKKSENLILMTPEEFKNQYNIDAVVNH
    QVISINREKKYVEVKNLLTEEVFQEKYDVLVMAPGAKAVRPKSIAGVDGKNVFVMKTVPDLQAFMFYAEANKVKDVAVIG
    GGFIGVEVAENAKKAGYNVAIIEAEKQILAPLDYDMVQIVNRHLYNQGVELHLGDGVKAIESDKVVLQSGKTVPAQAVIL
    SIGVAPNTQLAREAGLELNEAGYIKVNHHYQTNDPDIYAVGDAIEVKDFFTGKATKLTLAGPAQRQARAAADHMYGRTYV
    NTGVIGSSSVKVFDMNVASTGMNEKQCQAQGIKYGFSYIIPKDGVGLMPGSKNLFFKLLYAEPSGQVLGAQAVGLGNVTK
    RIDVIATTIMLHGNLEDLKELELEYSPNYGTAKDVVNHAALVALNLLNGEFKKVPVTAARKLVEENAFIIDAREENEYAV
    GHVVNAINIPLSQFRNRLDEIPHDRPVYIY
    CRSSQRSYNMVRALGQRGYTNVYNMDGSFLGISEYEFYNDQVTGRKPIVT
    AYNFN

    >gi|289450109|ref|YP_003475828.1| YeeE/YedE family protein [Clostridiales genomosp. BVAB3 str. UPII9-5]
    MNEDGTGNMKHTERIVGWIFLIAVLLAGYFLLPTSMLFFRLIIGGLLGYALSRGYMGFAGSVNRAYLTGSTRLMRTLMLM
    FFVSAAGTVAVLFQADATKFDLWVNPINFGLLLGGIFFGFGMAFSSCCASGVLTDLVTALPRALITLVFFCAGVFLGFPL
    QNTAGWIKDSWLTSPTGAAIGTKGVYFPDYFKFDGLDGYLGALAVTGVLCIIVVRLSRYYENKRKKTGEYFGHFDEGVQL
    KIAADKLSENDVPFFSATAYERYFVRPWSLRTAVIVISFIFVVLMGVTKAGWGASTPYGFWFGKVLMQFGVSTDAIVAFT
    HGAAKPYELPFLLHPITLQNIGILLGTAFYLLSAEQLRDAVKAGYRISAKQGLFYAIGGLAMGFGTRLSNG
    CNVGALYTP
    IANFSLSGWIFLVVMVLGGILGNKIAKKVGL

    >gi|289450168|ref|YP_003475790.1| electron transport complex, RnfABCDGE type subunit E [Clostridiales genomosp. BVAB3 str. UPII9-5]
    MSEGKISLKAEFTKGIIRENPVLRLVLGTCPTLATTTSVESAFGMGMAAAIVLVCSNTVISALRKLIPDKVRIPAYIVII
    ATFVSIVQMLVKAYVPAIDKQLGIYLPLIVVN
    CIILGRAEAFAGKHGVLASAIDGLGMGIGFTCALLCMGLFREILGAGS
    VLGHSILVGGIEPIAVLGLAPGGFFAFGILMALANHLAEKKGKPKASLDCYSCPLSTICSATGGKGVEALAPKPAKPVRP
    AAAKPIGAAAAPAAAKPAAPTDPAAAKPAAPAATEAVTAAQTTRPTNETVTSAATPAPTVSREAKAPESASAPATPVKSE
    EKEAK

    >gi|289450695|ref|YP_003475789.1| electron transport complex, RnfABCDGE type subunit A [Clostridiales genomosp. BVAB3 str. UPII9-5]
    MSTSLLFILFTAILTKNFVLAQFLGICPFLGVSKKLETAMGMSVAVIFVMVLATAVTFPINQYILEQFHMTYLQTLVFIL
    VIAALVQVVEIVLKKFMPPLYQALGIYLPLITTN
    CAVLGVVLLNLKESYGYVQSLVNSFGAGVGFMLALFIFAGVRRHLE
    TTNPPKFLQGLPIVLISASFVSMAFLGFAGIIDNIFK

    >gi|289449986|ref|YP_003475788.1| electron transport complex, RnfABCDGE type subunit B [Clostridiales genomosp. BVAB3 str. UPII9-5]
    MNGLISVSVLALHPVLLAVILVAALGILLGLGIAVASYFLAVKEDPKAAELVEILPGANCGACGFSGCAGYAAALASGKE
    VNCGLCAPGGAKVAKLVAACMGTAAGSVKPECAQVLCQGNCNNMNKAFDYAGIQT
    CAAMSLVSHGPGACDFGCLGLGDCA
    AACPFDAIRVIDNLAVIRSDMCKGCKKCVSVCPQKIIKMFPREEKKATVYCNNQDKGPTARKACKTACIACGACVRSCPQ
    KAIEIVDNHAVIDITKCTGCMTCVNKCPTSAILPQLIPAAAEE

    >gi|289450029|ref|YP_003475623.1| putative thioredoxin-disulfide reductase [Clostridiales genomosp. BVAB3 str. UPII9-5]
    MNLFDVIIVGAGPAGLTAALYAGRAGLKTLVFEAGVPGGKMLSTSDVENWPGSMPTTGPELAEKMTEHAFRFGAEQVNAQ
    ITDVHKEGNLVVAVDSEGKVYHSKAIILATGSTERHLGIKGEADYAGMGVSY
    CAVCDGAFFRNKTVTVIGGGNSAFEEAV
    YLTKFAKQVYIVLRRDVARADAVPVQQAMDNPKIKVIYNKKPQEILGNGMQVTGVLFADSVTGDTMTLPTDGVFPFVGLS
    PVTSYIKADVLNKAGFVVAKPDMSTDIPGIFSAGDCRNTVLRQIVTAGGDGAIAAQSANAYVQTWQA

    >gi|289450056|ref|YP_003475610.1| AhpC/TSA family antioxidant [Clostridiales genomosp. BVAB3 str. UPII9-5]
    MRRQIKYLILVIFILFIFGSGYYYYRNNTVTPPSAAAPGSSEAAMQADAAAGKPLDPPDMFFSDVENTVKHLSEYKGKVV
    ILNFWASW
    CSVCDAEMPDFNKLYEKYKSNSQVQFLPVAVVDGQRETVEKAKNYMKAKGFGLPLFFDLQGQMFNSIGLPGL
    PVTLIFNKDGRLISIAPYTEQTKPYYVHVGAMPGDLLEKIIEGELAK

    >gi|289449564|ref|YP_003475609.1| thioredoxin [Clostridiales genomosp. BVAB3 str. UPII9-5]
    MRILKQDEFETEVLNSKLPVLVDFYAEWCGPCKMLAPILEKVAARVEGKANVVKIDIDQANELAVKFGIMSVPTMIFFKA
    GQPVFKKIGLQQADALVNAIEAAL

    >gi|289450296|ref|YP_003475465.1| NADH oxidase [Clostridiales genomosp. BVAB3 str. UPII9-5]
    MGKKVVIIGANHAGTAATNQLLSLKDGSQVTVLDRNSNISFLGCGMALWIGHQISCGDGLFYSNKAALEAAGATVKMETE
    VTSVDYANKKVFYTTKDGQKGEESYDKLILSTGSLPVIPPIPGLDLPYIQKAKLYQDAKLAVDQIKNDPSIKKVTVVGAG
    YIGAELAEAYERQGKEVVLIDALDRILGTHFDRDFSNVMAERLKSHGIKLALGEKVQRFEGEGRVQRVVTDKGVYDTDLV
    MMCIGFRPNNELAKGHLDLFVNGAIKVNKRQETSMPDVYAIGDCATVFDNSINDTNYIALATNAVRSGLVAALNVGGVAI
    ESTGVQGSSGLCLYGLKMVCTGQTVETAAKHGIEAKMTEFEAQQKPAFMDEVGPNPNVKIRIVYRADNRQVIGAQLMSEY
    DMSATIHMFSLAIQEHVTIDRIALLDIFFMPHFNMPYNYITMAALSAK

    >gi|289450658|ref|YP_003475354.1| glutathione peroxidase [Clostridiales genomosp. BVAB3 str. UPII9-5]
    MTEIYNYSVKNQKGEDISLNQFKGKVLLIVNTATGCGFTPQYKKLEEIFEKYHYQGFEIIDIPCNQFAGQTPGTDEEITN
    FCTLKYGTKFPQMAKSNVNGDDALPLFEYLKSQKGFSGFGKGPKALMMSVMLKKIDKDYKNNPDIKWNFTKFLVDRDGNV
    VSRFEPTESMHEVAKAVESLL

    >gi|289449454|ref|YP_003475329.1| ArsC family protein [Clostridiales genomosp. BVAB3 str. UPII9-5]
    MRILIGLKRCSTCKNVEKILKDKNLVYEYREIDKHRPTKDELSAWAKNYGVPLSKLFNTSGVIYREQHLAERRKSMSEDE
    QIELLAGNGMLVKRPILLSDEPGEPSILVGRDISKKIDAANAVSTAKN

    >gi|289450269|ref|YP_003475232.1| glutaredoxin-like protein [Clostridiales genomosp. BVAB3 str. UPII9-5]
    MQKVTIFILKDCPFCKKAQKMLSELKSAYPELSGIEVEIIDEAVEPALADCYDYYYVPAFYVNGVKKHEGIVDKSKVENI
    LRSAL

    >gi|289449410|ref|YP_003475222.1| methylated-DNA-[protein]-cysteine S-methyltransferase [Clostridiales genomosp. BVAB3 str. UPII9-5]
    MLLERLVLSKLYHTEPTKIPFMSAVFSSAHQRGSKAAAVRLSDNSVLPYVINSWPGAADCAFISLGPLLTEDKWGEYTAW
    NKQALRLILEDLCRNSSYNLYLLSIKASETKLLNDLVDLGFACSTLGDYFDTEGNSLYRILTLRRSDYRQLKWYIVGDFG
    PGFVAVFGSAIWVEKVEFLQFSQLSVDPWLTQTGYRLGIVDEDCKVISRRRFNSDVKQHLFEAQGDINLPALRDAAEQIY
    AYLHDELREFDVKINPDAGTAFQQIIWRLLQKVSYGHTTTYTELAEAYLAENNYSNPRRDGKMVTARNLTRAIGAACAAN
    PLPILIP
    CHRVLGVKGKLVGYKDGINIKAYLLDKELLGVKDEPKQ

    >gi|289450830|ref|YP_003474771.1| peroxiredoxin [Clostridiales genomosp. BVAB3 str. UPII9-5]
    MSLINKQVSNFKVQAYHNDEFKEVSLNDVLGKWSIFFFYPADFTFVCPTELEDLAANYEAFKKAGAEIYSVSTDTHFVHK
    AWHDASSTISAIKFPMLADPTHVLCRDFDVLIEEAGIAERGTFIVNPAGRIVAYEVNAGNIGRNATELLRKLQACQFVAE
    HGDLACPAKWHPGEKTLKPGIDLVGKI

    >gi|289450665|ref|YP_003474456.1| copper-exporting ATPase [Clostridiales genomosp. BVAB3 str. UPII9-5]
    MTKAKFTVSGMSCAACALRVEKAVRQLEGVRTANVNLLTNSMQVEFAADKTGVAEIISQVDKVGYAAEEVGGRARDGRCD
    SSFAGGSRSKSRGQKTSNGGPEMLSETAELIAKGMAGTAAELRMTKKRLIGSAVFGLPLFYIAMGHMMHWPLPNFLLEPE
    NCLVFGLIQLALSLAVCLINRSIFLHGLKNLYYLAPNMDSLIAVGAGAAMLYGWVELAIMGYQLGHCELNAAVKLVSNLY
    FESAGTILLLIMLGNFLEIRAKGKSSEVIGKLVSLVPPRATVLVDGVPTEKPVGKLGLGDIILVKAGEVIAADGLVVEGS
    GTVDESMLTGESLPVCRKTGDTVNGATLNLSGYLHVKVTRLGEDSMLAQIIRAVDEATLSKAPIAKIADKVSGIFVPVVI
    GLAVLTGIGWLLAGAAAATALNFAICVLVISCPCALGLATPTAITVGAGVGAGKGVLFKSAAEIERLAKVDFAVLDKTGT
    ITYGRPEVTDVLPNKGVTEAELLQLAAALEVKSEHPLAGAIMAAAAKAKIDHTVFSLESFVQVPGGGIKAKIQGTECLGG
    NRRLLEKAGIDLGEWQAVTESLAAAGKTPLIFSSGGVIAGVIAVADVVKPESAAAVKCLRHLGLATLMITGDNKYTAAVI
    GKAVEVDEVVAEVLPQEKAARIAELQKCGKIVIMVGDGINDAPALVQADVGVAIGGGTDIAIEAADVVLMHGKLTDLVVA
    VKLGRAVLRNIKENLFWAFAYNVLGIPLAAGIFYPWTGIRLTPMLAALAMSCSSIFVVTNALRLRLWRGKLKK