Clavibacter michiganensis sepedonicus

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|170781091|ref|YP_001709423.1| putative metal transporter ATPase [Clavibacter michiganensis subsp. sepedonicus]
    MADPASGSAAEEGASGADGAPAEEGAVLTRVDLDVQGMTCASCAMRIERKLGRMPGVEAAVNYATHRARVQLPAGTSVAD
    AIRTIERTGYRASERAGWGSGAADGMPGSAAVPSAPASAPASDERAPVAVAAPRVRPDAPDAAASDPAPPPAPTDAPTRD
    AVAARRPDADELALRQRLVVSAALTVPVFLMAMIPALQFDDWQWLSLTLAAPVAVWGAWPFHRSAAVSARHGGVGMDTLV
    SIGVAAAFLWSLYALFLGDAGEPGMRMTMSLVSEPGGGSGDVYLEVAAAVTVFLLGGRYLEARAARASGAALAALLDLAA
    KDVAVVRDGVETRIPIRELRVGAEFVVRPGERIATDGVVVDGSSAVDRSLLTGESLPVEVGPGDDVTGATLNAGGRLLVR
    ATRVGEETRLARMAALVEEAQTGKARIQRLADRVSAVFVPVVLVLAAGTLVGWLLLGFPPEAAFTAAVATLIIACPCALG
    LATPTALLVGTGRGAQLGILITGPEVLESTRRIDTVLLDKTGTVTTGVMSLVRAVPAAGVDADELVRLAAALEQRSEHPV
    ARAVVETAGTGSVPAVEGFVATPGLGVHGVVDGRAVAVGRPSWLAEQWAARPGAPLAEALDEAEAEGSTVVAVAWDGAVR
    GILAVADTLKPTSAEAVRRLRALDLRPVLLTGDTAGAAHRVAAEAGIDEVIAGVLPEGKLEAVRRLQAEGRVVAMVGDGV
    NDAAALAQADLGIAMGTGTDAAIEAGDITIVRGDLVLVADAVRLARRTLGTIRGNLFWAFAYNAAAIPVAMLGLLNPLVA
    GLAMALSSVFVVTNSLRLRSFR

    >gi|170781115|ref|YP_001709447.1| putative peroxidase [Clavibacter michiganensis subsp. sepedonicus]
    MTETTRLEKGQPAPDFTLPDQDGSPVTLSDLRGQDVIVRFYPAAGTPGCTTQACDFRDSMDSLQGAGYRVLGISKDPQED
    LARFREEQGLGFTLLSDPDLEVHRAYAAYGEKSLYGKKVTGVIRSTVVVDGEGRVTLPLYNVKATGHVASLRKKLGVDA

    >gi|170781139|ref|YP_001709471.1| putative glutathione peroxidase [Clavibacter michiganensis subsp. sepedonicus]
    MTHPRLDEIPLTTLQGEATTFGAYADKVVLVVNVASRCGLAPQYEKLEQLQRTYGERGFTVIGFPSNQFLQELGSAEAID
    EYCSTTWGVTFPMMEKVKVNGRSAHPVYAELTKTPDAEGKAGRVKWNFEKFVVTPSGAVHRFRPTVEPDAPEIVSLIEAE
    LPA

    >gi|170781153|ref|YP_001709485.1| hypothetical protein CMS_0722 [Clavibacter michiganensis subsp. sepedonicus]
    MTSSQGAGVPEDLDAATAKARTATGDSWLLDVREPDEWEAGHSAVAHHIPMGELEARVAEIPTDRHIAVVCRSGHRSGIA
    TQALLRGGFAASNVTGGMHAWSEMGGDVVTDDGQPGRVA

    >gi|170781241|ref|YP_001709573.1| putative DNA-methyltransferase [Clavibacter michiganensis subsp. sepedonicus]
    MTDPDDTVPFLDADALEAADPTAPALDALRLRLADRAEADGSLDVGFTTIDSPVGPLLLAATDRGLIRVAYSREDHDTVL
    GDLARRLGPRILRAPKRLDQAARELDEYFAGRRRAFDLPLDRRLSTGFRDRVQRLLPEIPYGSTRTYREVAETAGSPDAT
    RAVGTACSTNPLPVVIP
    CHRVLRSDGTLGGYIGGLAAKTTLLELEGRI

    >gi|170781306|ref|YP_001709638.1| putative oxidoreductase [Clavibacter michiganensis subsp. sepedonicus]
    MDITQRIEGQQKWDAVVIGGGVAGSSAALMLARARRSVLVVDAGQPRNAVAAHMHGVLGHDGKPPRQLIAEGRREIEGYG
    GVVVDGRVERVAALEDPAGPRFRVTLDGGAEVTARRVILAAGLADVLPEVPGLAAHWGAGVVV
    CPYCDGYEVRDRRIGVL
    ATGPGSLHHVQMLRQWSADITFLVAGGTADGAPLEIDAATRAGIDARGIRVEEAAAVRVLGERGALEGVELADGRILELD
    SLFAMPGVAPRDGFARALGAATEETPWGPFVAADPTGQTSVPGLLIAGNASSGSANVPVAMAAGTMAGAMANAGMVTEDV
    AIAVAAAPAAVAR

    >gi|170781387|ref|YP_001709719.1| putative hydroperoxide resistance protein [Clavibacter michiganensis subsp. sepedonicus]
    MDALYTAEALATGAGRDGRVAVSYSDLALDLSIPKEMGGSGEGANPEQLFAAGYAACFHSALQGVARARKVKIADSSVGS
    RVSIGSNGQGGYQLAVHLEVVIPGVEHDLAQELADQAHQV
    CPYSNATRGNIEVTVTVSDD

    >gi|170781503|ref|YP_001709835.1| hypothetical protein CMS_1094 [Clavibacter michiganensis subsp. sepedonicus]
    MEEGEFTRDTNYIEDRILRDGSQGWPVEAGRYRLVAARACPWANRSVIVRRLLGLEDAISLGLPGPTHDARSWTFDLDPA
    GRDPVLGTERLQESFFARFPDYPRGITVPALVDIPSGQVVTNDYPQITLDLSTEWTEHHREGAPDLYPVPLRAEIDEVAD
    LVFRDVNNGVYRCGFAGSQEAYEKAYDRLFGRLDWLSDRLATQRYLVGDTITEADVRLFTTLARFDAVYHGHFKCNRQKL
    DEMPVLWAYARDLFQTPGFGDTIDFVQIKQHYYLTHTDINPTRVVPVGPETWGWLEPHGREELGGRPFGDGTPPGPVREG
    ERVPEGHGAVPRGERETRPSEARASVSGTPVPGTADAGSAGPA

    >gi|170781522|ref|YP_001709854.1| hypothetical protein CMS_1110 [Clavibacter michiganensis subsp. sepedonicus]
    MAPETSSYVPAPGRITMFSTTWCGYCRRLKAQLDRAGIGYDEVDIEQVPGTAELVEAINGGNQTVPTVLFPDGSSATNPS
    LADVTAKVA

    >gi|170781681|ref|YP_001710013.1| hypothetical protein CMS_1277 [Clavibacter michiganensis subsp. sepedonicus]
    MTVTDPVTDPVDLARPDAFTQEGLGWVPWLAPVDEADLDDAQRAALVEPARARMPYFRLLARDPAALEARTLTDLDVFHN
    PDGGIGRAERELAAAATSRVNGCVF
    CASVHAAAATRFSGRGDDVQRLLDQGRGAPLGDDRWDAVVAASVALAATPLAFGS
    ADVARLRAAGLDDVAVVDVINGAAFFNWANRLMLSLGEPEVPASRRGAGT

    >gi|170781747|ref|YP_001710079.1| putative nucleotide-disulphide oxidoreductase [Clavibacter michiganensis subsp. sepedonicus]
    MSHEMTDTPQDQRYDLVIVGAGSGNSIVDERFADQRVLLVDDGEHFGGTCLNAGCIPTKMLVHVADVAAGTQDGAALGIR
    ASVDAVDWPAISARVFGRIDAISEGGREWRESGSENVTLLRESVGFESPGVLVSASGQRIVADRVVLAAGSRPRPLQAVY
    APDPAIHDSDSIMRIAQLPTSLLIVGGGYVAAEFAHVFSHLGVHVTQVARSAHLLGNLDADVSTRFTTLARTQWDVITDC
    EVEEIERDGDVLRSRLASGHLVETEAVLVALGRVPNTDTLAVANAGYDLHDDGRIVVDDRQRVLAGGEPVPGVFALGDIS
    ADHQLKHVANHQARVVQHNLLHPEDLIGGAPGPAPQAVFSRPQIGSFGLTEAEARAAGPVVTVEQPYSSTAWGWALEDTT
    SFCKLVVDPRDGGTLLGAHIIGSDSAALIQPLLMAASLGHPVTGLARAQYWPHPAVTEIVENALLAAESAVADWARENGG
    GDAPAGAGRS

    >gi|170781784|ref|YP_001710116.1| putative DNA-binding protein [Clavibacter michiganensis subsp. sepedonicus]
    MTDTTLTETAEAAHRVGLTDTAASKVKSLLQQEGREDLRLRVAVQPGGCSGLIYQLYFDERELDGDATVDFDGVEVIVDK
    MSVPYLDGATIDFEDTIQKQGFTIDNPNAGGSCACGDSFH

    >gi|170781824|ref|YP_001710156.1| putative pyridine nucleotide-disulfide oxidoreductase [Clavibacter michiganensis subsp. sepedonicus]
    MTGDSYDVVVIGAGPAGLSAALNLVRARRRTLVLDSSRPRNAATLMSHGFVTRDGISPLELRKLGQVEVESYDEGEFQLA
    VVQSAEPAEGGFTIRAKGVRRAPDREVHARRILIATGLVETLPDLPSIRAYYGTAVHS
    CMECDGYEKADEPLFLIGETDD
    LVERALLLSQWSRDIVVFTNGVAHIDEAGERGLASLGIRVDRRPVADIEGERAVVTGIRMQDGSVVPRTGGFVRPRYSTA
    LDFLAGLDLDTDHDGHIAVDAEGRTSHAGVYAAGDSSQPGPQQLIIAAGFGARAASAINRDLLPRI

    >gi|170781848|ref|YP_001710180.1| putative oxidoreductase [Clavibacter michiganensis subsp. sepedonicus]
    MTSYDLIVIGAGPVGENVADRAKQGGLSVLVVESELVGGECSYWACMPSKALLRSGSALRAARAVAGSREAVTGELDVAA
    VLERRNSFTSSWDDQGQVSWLEGIGIELARGHGRISGPRRVTVTAPDGSVAEHEAAHAVVVSTGTAALLPDIPGLAEAQP
    WTSREATSVEVVPTSIVVIGGGVVAAEMATAYASLGSAVTIVARSGLLGGQEPFAGELVGDSLKGMGVDVRLGASPSRVA
    RDGDEVTVELSDGSSVTAAEVLVATGRTPRTEDLGLDTVGLEAGAYLDVDDTMLVTGGVNAESPWLYAVGDVNHRALLTH
    QGKYQARAAGEVIAARATGGTVDDSPWGVHVATADHRAVPQVTFTDPEVASVGLTAKAADDAGIRARVVDYDLGSVAGSS
    LHADGYAGQGRMVVDEDRGVIVGVTFVGPDVAELLHSATIAVVGEVPLARLWHAVPSYPTISEVWLRLLETYGRPTA

    >gi|170781887|ref|YP_001710219.1| hypothetical protein CMS_1492 [Clavibacter michiganensis subsp. sepedonicus]
    MSDVQSRPRTTAVEFWFDPSCPWAWMTSRWVDEVARHRDLDITWRVMSLAVLNEDKADDPNFAAFLPRALRFTRLVAAVE
    AEHGAEHVKPLYDALGTRIHLRDQKDADVVIPEVLAELGLPAGLAETSRTDRYDEPMRASHFDGIERVGQDVGTPVIAVD
    GVAFFGPVISPAPKGEEAVRLWDGVVAVAAYPGFFEIKRSRTVGPIFD

    >gi|170781934|ref|YP_001710266.1| peptide methionine sulfoxide reductase [Clavibacter michiganensis subsp. sepedonicus]
    MQTFILAGGCFWCLDAVYRTLDGVQDVISGYIGGHTAHPSYDAVCTGATGHAEAVKVVFDEEVIPADVILDVFFTLHDPR
    QLNRQGADVGTQYRSAMFPADAEQEQLFRDAIARAGDLLDGTPVTTIEPLGTWHDAEDYHQDFFAKNPGQGYCNAVAVPK
    VNKVRKSFAQYVRAA

    >gi|170781945|ref|YP_001710277.1| hypothetical protein CMS_1553 [Clavibacter michiganensis subsp. sepedonicus]
    MTDSTAPALPAIRVDVWSDIACPWCYVGKRRFERGARDFQARTPDAPEIAITYRSFELAPDTPVDFQGTEVDFLAGHKRI
    PADRVATMLDDMTRLAAAEGLAYDYDALQHTNTVLAHELLHLARVRGVQLEMVERLLKAYFTEGRHVGRVPDLVELAVEV
    GLDADEVREALESHRHLDDVRADQAQALAYGIQGVPFFVIDERFGISGAQDPSVFTSALGEALAARDGDTVRVVAGEEAT
    R

    >gi|170781996|ref|YP_001710328.1| hypothetical protein CMS_1605 [Clavibacter michiganensis subsp. sepedonicus]
    MPGVVWLLVPDRGHLSARKDPHPMALANDTQAPDFELANQFGERVRLSEYRGHRAVALVFFPLAFSGTCTGEMCQLEENL
    GLFADSRVELIGISVDSKHTLRAWAEQQGIDFQLLADFWPHGQVAKEYGVFLEGKGFANRATFLIDTRGIIRGSFITAPG
    EARELEAYRTAIRDLALVPA

    >gi|170782016|ref|YP_001710348.1| dihydrolipoamide dehydrogenase [Clavibacter michiganensis subsp. sepedonicus]
    MSEQNFDVVVLGGGSGGYAAALRAVQLGKTVGLVEKGKLGGTCLHRGCIPTKALLHSAEVADVSRESEKYGVIATFDGVD
    IAKVNAYREAIVASKYKGLQGLIKARGITVIEGEGRLTSGTTVQVGDQTITGKSVVLATGSYSRTLPGLEIGG
    CVITSEQ
    ALELDYIPKKVAILGGGVIGVEFASVWRSFGVEVQIVEALPHLVPNEEESISKQFERAFRKRGIAFSLGVRFKSVMQHDQ
    GVQVALEDGTTYDADLLLVAVGRGPATQGLGFEEAGVKTDRGFVLTDERLQTSVPGVYAVGDIVPGLQLAHRGFQQGIFV
    AEEIAGNKPVVVEDINIPKVTYSDPEVASVGYSEAKAVEKFGADKVSSYEYNLGGNGKSSILGTAGSIKVVRVQDGPVVG
    IHMIGVRVGELIGEGQLIVNWEAYPEDVANLVHAHPTQNEALGEAHLALAGTPLHAL

    >gi|170782042|ref|YP_001710374.1| putative thiosulfate sulfurtransferase [Clavibacter michiganensis subsp. sepedonicus]
    MAVEPDTTPRFAEYAHPERLVSGDWLQERLADGALTPGLVVVESDEDVLLYETGHIPGAVKLDWHTDLNDPVQRDYVDGE
    RFAQLMSERGIARDSTVVIYGDKSNWWAAYALWVFTLFGHEDVRLLDGGRDKWIAEGRPTTTDRPEVSPVEYPVVERRDE
    EIRAFKDDVLAHLGNPLIDVRSPEEYTGQRTTAPAYPEEGSLRAGHIPTSRNVPWAKAAAEDGSFRTRAELDAVYREGAG
    LGDGDDVVVL
    CRIGERSSHTWFVLTHLLGFEGVRNYDGSWTEWGSAVRVPIVQGAEPGELPAR

    >gi|170782091|ref|YP_001710424.1| putative pyridine nucleotide-disulphide oxidoreductase [Clavibacter michiganensis subsp. sepedonicus]
    MRSVIIGGVAGGMSAATRLRRLDEGREIVVFERGAYVSFANCGLPYHVGGVIPERASLLLQTPESLAARFRLDVRVRHEV
    LAIDATAKTVTVRDLEAAADQVLEYDDLVIAAGAGTASSTPDGGVPSSTLRSVEDVDGIMALLDGRTDAHAVVVGAGFIG
    LEAVENLLARGVRVTLVQRGDQVLSPLDPEMAAPVHETLHAAEVDVRTGTTVTGGSAGHVHLSDGTRVRADLVIQAAGVH
    PETGLARGAGLSIGPSGGIAVDGRQRTSDPSIWAVGDGVEKIDHLDGAPTLVTMAGLANRHGRAAADDIVGAAVTDAAPA
    LGTAILGILGITVGLVGWNEKRLVAEGRRHRIIHTHPASHAGYYPGAQQMAIKLLVDPDDDRILGAQIVGRDGVDKRLDV
    IAVAMTGGLTASALSRLELAYAPQYGSAKDPVNLLGYVAENAATGTTRSLQWHELEAALDAGATLVDVRTAGEHASAAIP
    GAVSLPLDELRARHDELPAGPLVVH
    CQVGQRGHTAARLLTQLGHDVRNLDGGWLTWRAGTASTTRTTAATAA

    >gi|170782092|ref|YP_001710425.1| hypothetical protein CMS_1712 [Clavibacter michiganensis subsp. sepedonicus]
    MKSITVHDLAAATGATIIDVREPDEYAGGHARSAVNVPLSELGERLDEIPTDQPVHVICQSGGRSARATDALAARGIDAI
    DVTGGTSAWIDADLPTDRA

    >gi|170782285|ref|YP_001710618.1| putative methylated-DNA--protein-cysteine methyltransferase [Clavibacter michiganensis subsp. sepedonicus]
    MTPSSAPAVAPARRPASPPRDGRPAPAAPDADPGCALAPAAGTLPHGAALLRVPSPVGRLELVAEGDRVVALSIATVGVL
    PLDHLDDRPTPVLAETARQLDEYFAGRRTSFEVPVRLTGTPFQVAVWEALARVPHGGVTTYGALAQAAGRPSGARAVGGA
    VGANRLCILVP
    CHRVLGSDGRVTGFSAGDGVATKVGLLALEGSVLS

    >gi|170782616|ref|YP_001710950.1| putative stress induced protein [Clavibacter michiganensis subsp. sepedonicus]
    MEPIYTAIAHASGGGRDGHVRSEDDRIDFDTRPPKEMGGSGEGTNPEQLFAAGYSACFLGATHLVGKNAGVDTKDAGVSA
    SVSIGDNGQGGFGLAVELDVYLPNVAPERRQEIADAAHQV
    CPYSNATRGNIDVKVTIVD

    >gi|170782647|ref|YP_001710981.1| putative oxidoreductase [Clavibacter michiganensis subsp. sepedonicus]
    MPESTDHADPATDAQPGAATEPERYDVAVIGAGPAGTAAALRAAELGASVVVLEAGRVGGTCVNTGCVPTRVLAKTARLV
    REVRSAGENGIGVGDPTPHWPSIVARVHEQVDRVRSLKDEAERFRAAGVTLIHEGRARFVDDRTLVLDSGRRITAGSIIV
    CVGGHSRRLPVPGAELATVPEDVLALPGIPRRLAVIGAGNTGAQLVTVFRSFGSEVTLLDVAPRVLTASDEAISEAVADA
    FTAQGVRVHTGIDTVTGLTKTGDGSITLLWRDGDRPQSSSFDAVIMATGWPADVEDLGLEHAGLEVERSAIPVDRYLRTR
    VPHILAVGDANGKDMLVQAAQSEGEAAAENAVLGVNRRIPLQLLPAGGFTDPDYAGVGLTQAEARERDSACVVARVPFAE
    VDRAVIDDREAGFLLLIADRRRELILGAHAVGENAVEVIQSVTTAMAAGVDVATLAHVRFAYPTYSAIIGIAARRLLQED
    DRAGELD

    >gi|170782689|ref|YP_001711023.1| hypothetical protein CMS_2357 [Clavibacter michiganensis subsp. sepedonicus]
    MPNRLADAVSPYLQSHADNPVDWRTWGEEAFAEARRRDVPVLVSVGYSTCHWCHVMARETFQDPALADRLNAGFVAIKVD
    REEHPEVDAALITAAGAFTDQLGWPLNVFTTPEGRTFHAGTYSPPEPRAGHPSFRQVLDAVADAWTTRRDQVEQGAGQLS
    AAIREASERGSVASPLPDAAALDRIAADLAAFEDPEHGGFGSAPKFPVAPVVLLLDTLATSGVLAPSRAEATRALVRRTL
    DAMAGSDLRDPVEGGFFRYSTRRDWSEPHYERMLYDNALLLDAYARAGDEEVAGGIAAFLTGTLRRASGGFASAQDSEST
    VGGRRVEGGYYALDAAGRAAEEPPAVDGKVLTGWNGLAIGALARAGRAFGRPAWIQAARDAADMLLAEHVRADGSLVRAS
    IDGRVSPAVATLEDHGMLADGLLALALATGEVGYAVRARGIVDALVQAADAASAAQPGAGEPQSGAAGFRVPTGADPVLA
    GFGLDLAADPSEGAYPSGLTAACSAARVLGRLTADPRYERAARAALATVAAGGATRPIAFGGALEQAAAIDAAGRQLVVV
    LPDAADRGDDPLAAIAHGLTRPPHVSLVVTETAARAWADAGFELLADRVAGSTATAYLCADFVCRLPVTTADALRAQLDD
    EAR

    >gi|170782698|ref|YP_001711032.1| putative sulfurtransferase [Clavibacter michiganensis subsp. sepedonicus]
    MEILITPTELDHAIRTRGDVRVIDVRWSLGGPPGRPLHEAGHIPGAVYADLDTELSRHGAPEEGRHPLPEPAALQEAARR
    WGVRAGDAVVAYDGGGSLAAARAWWLLRDAGIADVRILDGALPAWTAAGLPLETGPVVPTPGDVTLASGLLAVVDEDGAA
    RVALDGVLLDARAEERYRGEVEPWDPRPGHIPGARSAPSSDALASDGTFRSRAELRARYAVLGVPDADEVAVY
    CGSGVSA
    ALEVAALAIAGIDAALYPGSWSAWANRPELPAATGAEPGGV

    >gi|170782861|ref|YP_001711195.1| putative sulfurylase [Clavibacter michiganensis subsp. sepedonicus]
    MGSSLPLVDLDGTHPGGRGLGGHGSGQDAQERRERHSRHLALPGIGMGGQSRIDQARVLVIGAGGLGSPVLQYLAAAGIG
    TLGIVDDDAVDLSNLQRQTIHGTPDVGRPKTSSAADSVHRTDPGVEVVEHAERLTNDNAIGILSGYDVVVDATDNFATRY
    LISDAAALVGVPCVWGSVYRWDAQVTVFWDAAPDGRGIDYRDVFPEPPADGAVLS
    CEEAGVFGAVCGTVGSLMVTEVIKL
    VTGAGQPLLGRVVVLDALAGTSRTIGVKRAKGRQRVTALADYDLFCGVGAATDGTELDAEEVERILASDERVVLLDVREP
    DERLVDSIPGHVAVPVRIVTVDPGAVPGEITDRVVVYCASGVRSRAAAAALREAGRDAVSLRGGIKSWRSVAGRA

    >gi|170782879|ref|YP_001711213.1| hypothetical protein CMS_2557 [Clavibacter michiganensis subsp. sepedonicus]
    MAGRAAGGAIRGLAYAGRMSATVLTLVGKPGCHLCDDARGVVTQVLEGLDATRAAEVTLEERSILDDPALADRFAEEIPV
    LLIDGRVHNYWRIDAERLRQALVER

    >gi|170782899|ref|YP_001711233.1| putative lipoprotein [Clavibacter michiganensis subsp. sepedonicus]
    MMPGVSRRSILAAAASAVLGAVALSGCTEDPLAAEFKAGDNKRYIAGDGTFTEIPLAERAAPVEFSGTLSDGTEITSADY
    VGAVTVLNFWYAE
    CPPCRLEAKDLQAASEEHAPDGVKFLGVNTRDQRPNVDSFDKTYGITYPSVLDVEDTSMQLAFAGTI
    APNAVPATIILDRQGRVASRVLGQIDPGVLRTLVKDTVAEAAG

    >gi|170783056|ref|YP_001711390.1| putative oxidoreductase [Clavibacter michiganensis subsp. sepedonicus]
    MTMEARWDAAPRIDQRERTRTMAYEIEKTDDEWRQELSPEEYAVLRQQATERPWTGELLDEERTGVYGCKACGAELFTSD
    TKFDSHCGWPSFYAPKESDAVKLYTDTSLGMKRVEVVCARCGSHLGHVFDDAPQTPTGDRF
    CMNSVSMSFRTAE

    >gi|170783127|ref|YP_001711461.1| hypothetical protein CMS_2828 [Clavibacter michiganensis subsp. sepedonicus]
    MAPPRSAAMRIPRIVGMARHENEKVRAIREKARIERALDDRRRKRRRLITQFSVAGGLVIVIAAIAGGVYLLGQSQAASA
    AGPVQDTTAALSTGDQVRIATEPTGVSVGAADAPVTMDVFEDYS
    CPHCAQYEAETGPLLDRIAATGQVRIVYHPIQIVTK
    YGVVAGSAAACVLAEEPDKWPAVHSALFDNHSTITDSWTHADFVTWLTTQGVTADAARTCVAEGRYSSWITSNTSDATSA
    GVTGTPTLRIQGDIVTTVAGQDLVDALTKAGADLPQGIAADS

    >gi|170783391|ref|YP_001711725.1| thioredoxin reductase [Clavibacter michiganensis subsp. sepedonicus]
    MRQIIIIGSGPAGYTAAIYAARANLTPLLIASSVEAGGELMNTTEVENYPGFTDGIQGPDLMMAMQAQAERFGTEVVLDD
    VTSVDLKGDVKRVTLGNGDVHESLAVIAATGSAYRKLGLPAEDRFSGHGVSW
    CATCDGFFFRQKTIAVVGGGDSAMEEAA
    FLTRFAEKVYVIHRKDSLRASKIMQDRAFENPKIEFVWNAQVVDITGGEKVDGVVLEDTVTGEQRRLALDGLFIAIGNDP
    RTHLFHQQLELTSEGTIAVEGRSSRTNLPGVFAAGDVIDPTYRQAITAAASGTVAALDAEHFLASLPDTLLDAASDGPDG
    PAGHGAPAAGSVVDPDGELVGADHQ

    >gi|170783392|ref|YP_001711726.1| thioredoxin [Clavibacter michiganensis subsp. sepedonicus]
    MSHSRDVTDASFQADVLDAEKTVIVDFWAPWCGPCKAVSPVLDQIAAENPGIELVKIDVDDNPEIAMKYKITSIPAMKVF
    QKGEVVKTVIGAKPKPALEQEFADFLK