Clavibacter michiganensis NCPPB 382

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|148271256|ref|YP_001220817.1| putative NADH oxidase [Clavibacter michiganensis subsp. michiganensis NCPPB 382]
    MRTVIIGGVAGGMSAATRLRRLDEEREILVFERGAYVSFANCGLPYYVGGVIPERASLLLQTPESLAARFRLDVRVRHEV
    VGIDAGAKTVAVRDLDAGTVDTVVYDDLVIAAGAGAAPGGTDGGVPSSTLRTVEDVDRIMALLNVTTDAHAVVVGAGFIG
    LEGVENLLARGVHVTLVQRGQQVLSPLDPEMATPVREALEAAGVDVRTGTTVTGATSGYVHLDDGTRVRADLVIRAPGVR
    PETGLARAAGLRIGASGGIAVDGRQRTSDPSIRAVGDGVEKIDHIDGTPTLVTMAGLANRHGRAAADDIAGAAKTDAAPA
    LGTAILGLLGLTIGLVGRNEKRLAAEGRPHRIIHTHSASHAGYYPGAQHMAIKLLVDPDDDRILGAQIVGRDGVDKRLDV
    IAVAMSAGLTASALTRLELAYAPQYGSAKDPVNLLGYVAENAATGTTRSIQWHELEDSLAAGATLVDVRTASEHATAAIP
    GAVSLPLDELRARHHELPAGPLVVH
    CQVGQRGHTAARLLAQLGHDVRNLDGGLLTWRAGTASTTRTTTGTAA

    >gi|148271257|ref|YP_001220818.1| hypothetical protein CMM_0079 [Clavibacter michiganensis subsp. michiganensis NCPPB 382]
    MTSITVQQLAASAGATIIDVREPDEYAAGHARSAVNVPLSELGERIDGIPADRPVHFICQSGGRSARATEALTACGIDAI
    EVTGGTTAWIDADLTTDRA

    >gi|148271398|ref|YP_001220959.1| hypothetical protein CMM_0219 [Clavibacter michiganensis subsp. michiganensis NCPPB 382]
    MSRITVDQLAALDSPVLIDVREPDEYAAGHAPGAVNLPMSQLDARVDEVPTDAPVHVICQSGGRSARATEALAARGVDAV
    DVEGGTSAWISAGHSVDRA

    >gi|148271421|ref|YP_001220982.1| 6-O-methylguanine-DNA methyltransferase [Clavibacter michiganensis subsp. michiganensis NCPPB 382]
    MTDPDDTIPFLDAAALERADPTAPALDALRLRLADRAEADGALDVGFTTIDSPVGPLLLAATDRGLIRVAYSREDHDTVL
    GDLARRLGPRILRAPKRLDQAARQLDEYFAGRRRAFDLPLDRRLSTGFRDRVQRLLPEIPYGSTRTYREVAETAGSPAAT
    RAVGTACSTNPLPVVIP
    CHRVLRSDGTLGGYIGGLAAKTTLLELEGRF

    >gi|148271486|ref|YP_001221047.1| putative sulfurtransferase [Clavibacter michiganensis subsp. michiganensis NCPPB 382]
    MSLSATDFFAAELTYETDPADLAADRANGAAPLVVDVRSDASWAQGRIPGAVHILGVELAARAAAELPDRDARVVVYCWG
    PG
    CNGSTRAALTLATLGYTRVQELIGGFEYWAREGFAVVSDAGRTRREPDPLTAPVD

    >gi|148271494|ref|YP_001221055.1| putative thioredoxin reductase [Clavibacter michiganensis subsp. michiganensis NCPPB 382]
    MEITQGIDGRHEWDAVVIGGGAAGSSAALMLVRARRSVLMVDAGQPRNAVAAHMHGVLGHDGKPPRQLVAEGRREIEGYG
    GVVVDGRVERVAALDDPDGPRFRLTLDGGAAVTARRVILATGLADVLPEVPGLAAHWGAGVVV
    CPYCDGYEVRDRRIGVL
    ATGPGSLHHVQMLRQWSADVTFLVAGGTADGAPLEIDAATRAGLDARGIRVEESAVVRALGERGALEGVELADGRTLPLD
    ALFAIPGVAPRDGIARALGAATEDTPWGPFVAADPMGQTSVPGLLIAGNASSGSANVPVAMAAGTMAGAMANAGMVTEDV
    AMAVALADAPTPAVGR

    >gi|148271594|ref|YP_001221155.1| organic hydroperoxide resistance protein [Clavibacter michiganensis subsp. michiganensis NCPPB 382]
    MDALYTAEALATGAGRDGRVAVSDSDLALDLSIPKAMGGSGEGANPEQLFAAGYAACFHSALQGVARARKVKIADSSVGS
    RVSIGSNGQGGYQLAVHLEVVIPGVEHDLAQELADQAHQV
    CPYSNATRGNIEVVVTVSDD

    >gi|148271748|ref|YP_001221309.1| putative thioredoxin [Clavibacter michiganensis subsp. michiganensis NCPPB 382]
    MPGVSRRSILAAAASSVLAAVALSGCTEDPLAAEFKAGDNKRYIAGDGTFTEIPLAERAAPVDFSGTLSDGTEISSADYR
    GSVTVLNFWYAE
    CPPCRLEAKDLQAASEEHAADGVRFLGVNTRDQRPNVDSFDKTYGITYPSVLDVEDTSMQLAFAGTIA
    PNAVPATIVLDRQGRVASRVLGQIDPGVLRTLVKDTVAEAAG

    >gi|148271787|ref|YP_001221348.1| hypothetical protein CMM_0608 [Clavibacter michiganensis subsp. michiganensis NCPPB 382]
    MAMARHENEKVRAIREKARIERALDDRRRKRRRLIAQFSVAGGLVIVIAAIAGGVYLLGQSQAASAAGPVQDTTAALSTG
    DQVRIATEPTGVSVGAADAPVTMDVYEDYS
    CPHCAQYEAETGPLLDRIAATGQVRIVYHPIQIVTKYGVVAGSAAACVLA
    EEPDKWPAVHSALFDNHSTITDSWTHADFVTWLTTQGVTADAARTCVAEGKYSSWITSNTSDATSAGVTGTPTLRIQGDI
    ITTVAGQDLVDALTKAGAQLPDGIAADS

    >gi|148271888|ref|YP_001221449.1| stress-induced protein, putative organic hydroperoxide resistance protein [Clavibacter michiganensis subsp. michiganensis NCPPB 382]
    MEPIYTAIAHASGGGRDGHVRSEDDRIDFDTRPPKEMGGSGEGTNPEQLFAAGYSACFLGATHLVGKNAGVDTKDAGVSA
    SVSIGDNGQGGFGLAVELDVYLPNVAPERRQEIADAAHQV
    CPYSNATRGNIDVKVTIVD

    >gi|148271975|ref|YP_001221536.1| putative thioredoxin [Clavibacter michiganensis subsp. michiganensis NCPPB 382]
    MATTELTAENFESIVDSNGIVVVDFWADWCGPCKQFAPVFDKSSEKHADIVHGKVDTEAQQFLAQQANISAIPTLMIFKD
    QTLIFSQAGALPAPALESLIEEVRAVDVAALKEQAAAEAAQATPGASADPTAI

    >gi|148272217|ref|YP_001221778.1| putative metal-transporting ATPase [Clavibacter michiganensis subsp. michiganensis NCPPB 382]
    MTDPASGSAPAPAADAAPASASDGGPVLTRVDLDVQGMTCASCAMRIERKLGRMPGVEAAVNYATHRARVQLPTGTSVED
    AIRTIERTGYRASERAGWGSAPADGVSGSAAAAAAAAAAAAASASAERAPVAVAAPPVRPDAPAAASDPAPAPAPEDPPA
    RDAVAARRPDADELALRQRLVVSAALTVPVFLMAMLPALQFPNWQWLSLALAAPVAVWGAWPFHRSAAVSARHGGVGMDT
    LVSIGVAAAFLWSLYALFLGDAGRPGMRMTLSLVTEPGGGSGDVYLEVAAAVTVFLLGGRYLEARAARASGAALAALLDL
    AAKDVAVVRDGVERRIPIRELRVGEEFVVRPGERIATDGVVVDGSSAVDRSLLTGESLPVEVGPGDDVTGATLNAGGRLL
    VRATRVGEETRLARMAALVEEAQTGKARIQRLADRVSAVFVPVVLVLAVGTLVGWLLLGFPPEAAFTAAVATLIIACPCA
    LGLATPTALLVGTGRGAQLGILITGPEVLESTRRIDTVLLDKTGTVTTGVMSLVRAVAAAGVDADELVRVAAALEARSEH
    PVARAVVEAAGAGSVPAVKGFVATAGLGVHGVVDGRAVAVGRPSWLAEQWAAEPDASLAEALRGAEAEGSTVIAVAWGGA
    VRGILAVADTVKPTSAEAIRRIRALGLRPVLLTGDTAGAAHRVAAEVGIDEVIAGVLPEGKLDAVRRLQAEGRVVAMVGD
    GVNDAAALAQADLGIAMGTGTDAAIEAGDITIVRGDLVLVADAVRLARRTLGTIRGNLFWAFAYNAAAIPVAMAGLLNPL
    VAGLAMALSSVFVVTNSLRLRSFR

    >gi|148272242|ref|YP_001221803.1| putative alkyl hydroperoxide reductase [Clavibacter michiganensis subsp. michiganensis NCPPB 382]
    MNETTRLEKGQPAPDFTLPDQDGTPVTLSDLRGQDVIVYFYPAAGTPGCTTQACDFRDSMDSLQGAGYRVLGISKDPQED
    LARFREEQGLGFTLLSDPDLEVHRAYAAYGEKSLYGKKVTGVIRSTVVVDGEGRVALPLYNVKATGHVASLRKKLGVDA

    >gi|148272289|ref|YP_001221850.1| putative thioredoxin reductase [Clavibacter michiganensis subsp. michiganensis NCPPB 382]
    MGDPGVAGTTATGDSYDVVVIGAGPAGLSAALNLVRARRRTLVLDSSRPRNAATLMSHGFVTRDGISPLELRKLGQVEVE
    GYEEGEFQLAVVQSAEPAEGGFTIRAKGVRRAPDREVHARRILIATGLVETLPDLPSIRAYYGTAVHS
    CMECDGYEKRDE
    PLFLIGETDDLVERALLLSQWSRDIIVFTNGVAEIDEAGERGLASLGIRVDRRPVADIEGERAVVTGIRMQDGSVVPCSG
    GFVRPRYSTALDFLSGLDLDTDDDGHIAVDAEGRTSHAGVYAAGDSSQPGPQQLIIAAGFGARAASAINRDLLPVI

    >gi|148272312|ref|YP_001221873.1| putative pyridine nucleotide-disulphide oxidoreductase [Clavibacter michiganensis subsp. michiganensis NCPPB 382]
    MTSYDLIVIGAGPVGENVADRAKQGGLSVLVVESELVGGECSYWACMPSKALLRSGSALRAARAVAGSKEAVTGELDVAA
    VLKRRDSFTSSWDDQGQVSWLEGIGIDLALGHGRISGPRRVTVTAPDGSVTEHEAAHAVVVSTGTAALLPDIPGLAESQP
    WTSREATSVEVVPTSIVVIGGGVVAAEMATAFASLGSAVTLVARSGLLSGQEPFAGELVGDSLRDMGVDVRLGGSPSRVT
    RDGDEVTVELSDGSAVTAAEVLVATGRTPRTEDLGLDAVGLEAGAYLDVDDTMLVTGDVNAETPWLYAVGDVNHRALLTH
    QGKYQARAAGEVIAARATGGTVDDAPWGVHVATADHRAVPQVTFTDPEVASVGLTAKAAEEAGIRTRVVDYDLGSVAGSS
    LHADGYAGKARMVVDEDRGVIVGVTFVGQDVAELLHSATIAVVGEVPVTRLWHAVPSYPTISEVWLRLLETYGRPTA

    >gi|148272353|ref|YP_001221914.1| putative methylated-DNA--protein-cysteine methyltransferase [Clavibacter michiganensis subsp. michiganensis NCPPB 382]
    MPSPVGRLELVAEGDRVVALSIATDGVLPLDHLDDRPSAVLAETSRQLGEYFAGLRTSFDVPVRLTGTPFQVAVWEALAR
    VPHGGVTTYGALAQAAGRPGGARAVGGAVGANRLCILVP
    CHRVLGSDGRVTGFSAGDGVATKVRLLALEGSVLS

    >gi|148272385|ref|YP_001221946.1| putative peroxiredoxin [Clavibacter michiganensis subsp. michiganensis NCPPB 382]
    MTDTTIQTQIADFDRGFAEQIGPDLSAVFAAEQRALREGGVPSGAVSPGDALPAATLVDPDGAEVDLHAALGSGPAVIVL
    YRGAW
    CPYCNLTLRQYQAELLPALRERGATLVAVSPQTPEGSAQAVAGGGLDFAVLSDPSNAFVRALGLLTEPTPEARAA
    HAQLGFDVADSNADGTGDIPFPTVIVVDADRRVSFADVHVDYTTRTEVPEILAAVDALLAR

    >gi|148272622|ref|YP_001222183.1| putative thioredoxin [Clavibacter michiganensis subsp. michiganensis NCPPB 382]
    MRVVMFTSLFCVPCQATRRVLADVQRLLAWLPVEELDVAAHPDLAEAESIRSTPTILVRAGDRQVLRAEGVPTAPQVLQA
    VVRAMDGPAPAGPSGASGRPDPA

    >gi|148272626|ref|YP_001222187.1| putative peptide methionine sulfoxide reductase [Clavibacter michiganensis subsp. michiganensis NCPPB 382]
    MQTFILAGGCFWCLDAVYRTLDGVQDVISGYIGGHTAHPSYDAVCTGATGHAEAVKVVFDEEVIPADVILDVFFTLHDPR
    QLNRQGADVGTQYRSAMFPADAAQEQLFRDAISRAGELWDGTAVTTIEPVGTWYDAEDYHQDFFAKNPGQGYCNAVAVPK
    VNKVRKSFAQYVRAA

    >gi|148272638|ref|YP_001222199.1| hypothetical protein CMM_1458 [Clavibacter michiganensis subsp. michiganensis NCPPB 382]
    MSDVENSPRTTAVEFWFDPSCPWAWMTSRWVDEVARHRDLDITWRVMSLAVLNEDKADDPNFAAFLPRALRFTRLVAAVE
    AEHGAEHVKPLYDALGARIHLRDQKDADVVIPEVLAELGLPAELAETSRTDRYDEPMRASHFDGIERVGQDVGTPVIAVD
    GVAFFGPVISPAPKGEEAVKLWDGVVAVAAYPGFFEIKRSRTVGPIFD

    >gi|148272764|ref|YP_001222325.1| hypothetical protein CMM_1583 [Clavibacter michiganensis subsp. michiganensis NCPPB 382]
    MTDSTAPALPAIRVDVWSDIACPWCYVGKRRFEAGARAFQSQTPGAPEIEITYRSFELAPDTPVDFQGTEVDFLAGHKGI
    PADRVATMLEDMTRLAAAEGLAYDYDALQHTNTVLAHELLHLARVRGVQLEMVERLLKAYFTEGRHVGRVPDLVELAVEV
    GLDADEVRESLETHRHLDDVRADQAQAVAYGIQGVPFFVIDERFGISGAQDPTVFASALGEALAARDGDTIRVVAGEEAA
    R

    >gi|148272804|ref|YP_001222365.1| putative thiol-specific antioxidant protein [Clavibacter michiganensis subsp. michiganensis NCPPB 382]
    MALANDTQAPDFELANQFGERVRLSEYRGHRAVALVFFPLAFSGTCTGEMCQLEENLGLFADSRVELIGISVDSKHTLRA
    WAQQQGIDFQLLADFWPHGQVAKEYGVFLEEKGFANRATFLIDTRGIIRGSFITAPGEARELEAYRTAIRDLALVPA

    >gi|148272824|ref|YP_001222385.1| dihydrolipoamide dehydrogenase [Clavibacter michiganensis subsp. michiganensis NCPPB 382]
    MSEQNFDVVVLGGGSGGYAAALRAVQLGKTVGLVEKGKLGGTCLHRGCIPTKALLHSAEVADVSRESEKYGVNVTFDGVD
    IARVNAYREAIVASKYKGLQGLIKARGITVIEGEGRLTSATTVQVGDQTVTGKSIVLATGSYSRTLPGLEIGGRVITSEQ
    ALELDYIPKKVAILGGGVIGVEFASVWRSFGVDVQMIEALPHLVPNEEESISKQFERAFRKRGIAFSLGVRFKSVTQDDQ
    GVQVALEDGTTYDADLLLVAVGRGPATQGLGFEEAGVKTDRGFVLTDERLQTSVPGVYAVGDIVPGLQLAHRGFQQGIFV
    AEEIAGNKPVVVEDINIPKVTYSDPEVASVGYSEAKAAEKFGADKVSSYEYNLGGNGKSSILGTAGSIKVVRVQDGPVVG
    IHMIGARVGELIGEGQLIVNWEAYPEDVANLVHAHPTQNEALGEAHLALAGTPLHAL

    >gi|148272849|ref|YP_001222410.1| thiosulfate sulfurtransferase [Clavibacter michiganensis subsp. michiganensis NCPPB 382]
    MAVEPDTTPRFAEYAHPERLVSGDWLQERLADGALTPGLVVVESDEDVLLYETGHIPGAVKLDWHTDLNDPVQRDYVDGE
    RFAQLMSERGIARDSTVVIYGDKSNWWAAYALWVFTLFGHEDVRLLDGGRDKWIAEGRPTTTDRPAVTPVEYPVVERRDE
    EIRAFKDDVLAHLGNPLIDVRSPEEYTGQRTTAPAYPEEGSLRAGHIPSSKNVPWAKAAAEDGSFKTRAELDAVYRDGVG
    LGDGDDVVVL
    CRIGERSSHTWFVLTHLLGFEGVRNYDGSWTEWGSAVRVPIVQGAEPGELPAR

    >gi|148272991|ref|YP_001222552.1| hypothetical protein CMM_1810 [Clavibacter michiganensis subsp. michiganensis NCPPB 382]
    MTSAQGAGVPEDLDAATAKARTTTGESWLLDVREPDEWEAGHSAVAHHIPMGELQARVDEIPTDQHIAVVCRSGHRSAIA
    TQALLRGGFAASNITGGMHAWSEMGGDVVTEDGQPGRVA

    >gi|148273005|ref|YP_001222566.1| putative peroxidase [Clavibacter michiganensis subsp. michiganensis NCPPB 382]
    MTHPRLDPIPLTTLQGEATTFGAYADKVVLVVNVASRCGLAPQYEKLEQLQRTYGERGFTVIGFPSNQFLQELGSAEAID
    EYCSTTWGVTFPMMEKVKVNGRSAHPVYAELTKTPDADGKAGRVKWNFEKFVVTPTGAVHRFRPTVEPDAPEIVSLIESE
    LPA

    >gi|148273024|ref|YP_001222585.1| hypothetical protein CMM_1843 [Clavibacter michiganensis subsp. michiganensis NCPPB 382]
    MTDTTLTETAQAAHRVGLTDTAASKVKSLLQQEGREDLRLRVAVQPGGCSGLIYQLYFDERELDGDATVDFDGVEVIVDK
    MSVPYLDGATIDFEDTIQKQGFTIDNPNAGGSCACGDSFH

    >gi|148273060|ref|YP_001222621.1| putative oxidoreductase ( E3 component of 2-oxoglutarate dehydrogenase complex) [Clavibacter michiganensis subsp. michiganensis NCPPB 382]
    MTDSPQDPQQDERYDLVIVGAGSGNSIVDERFGDQRVLLVDDGEHFGGTCLNAGCIPTKMLVHVADVAAETRDGAALGIR
    ASVDAVDWPAISARVFGRIDAISEGGREWRESGMGNVTLLRESVGFEAPGVLVSASGQRITADRIVLAAGSRPRPLQAVY
    APDPDIHDSDSIMRIAQLPASLLVVGGGYVAAEFAHVFSHLGVHVTQVARSAHLLGNLDADVSTRFTTLARTQWDVITDC
    EVEEIERDGDVLRSRLASGHLVETEAVLVALGRVPNTDTLAVANAGYDLHEDGRVVVDDRQRVLAGGEPVPGVFALGDIS
    ADHQLKHVANHQARVVQHNLLHPDDLIGGAPGPVPQAVFSRPQIGSFGLTEAEAREAGPVVTIEQPYSSTAWGWALEDTT
    SFCKLVVDPRDGGTILGAHIIGSDSAALIQPLLMAASLGHPVTGLARAQYWPHPAVTEIVENALLAAESAVAAWARENGQ
    GDAPAGAGRS

    >gi|148273135|ref|YP_001222696.1| hypothetical protein CMM_1954 [Clavibacter michiganensis subsp. michiganensis NCPPB 382]
    MTAADPVTDPVDLARPDAFTQEGLGWVPWLAPVAEADLDEAQRAALVEPARARMPYFRLLARDPAALEARTRTDLDIFHN
    PDGGIGRAERELAAAATSRANGCVF
    CASVHAAAATRFSGRGDDVQRLLDQGTGAPLGDERWDAVVAASVALAATPLEFGS
    ADVARLRAAGLDDAAVVDVINGAAFFNWANRLMLSLGEPEVPASRRGAGA

    >gi|148273295|ref|YP_001222856.1| putative glutaredoxin [Clavibacter michiganensis subsp. michiganensis NCPPB 382]
    MAPETSSYVPAPGRITMFSTTWCGYCRRLKAQLDRAGIGYDEVDIEQVPGTAELVEAINGGNQTVPTVLFPDGSSATNPS
    LADVTAKVA

    >gi|148273305|ref|YP_001222866.1| putative glutathione S-transferase [Clavibacter michiganensis subsp. michiganensis NCPPB 382]
    MTDQATPAGSNEAGAPGRYVEEGEFTRDTNYIEDRILRDGSQGWPVEAGRYRLVAARACPWANRSVIVRRLLGLEDAISL
    GLPGPTHDARSWTFDLDPDGRDPVLGTERLQESFFARFPDYPRGITVPALVDIPSGQVVTNDYPQITLDLSTEWTEHHRE
    GAPDLYPVALRAEIDEVADLVFRDVNNGVYRCGFAGSQEAYEKAYDRLFGRLDWLSDRLSTQRYLMGDTITEADVRLFTT
    LARFDAVYHGHFKCNRQKLDEMPVLWAYARDLFQTPGFGDTIDFVQIKQHYYLTHTDINPTRVVPTGPETWGWLEPHGRE
    ELGGRPFGDGTPPGPVREGERVPDGHGAVPRGGRETRPSEARAWVSGTPVPGSADDGSADRA

    >gi|148273398|ref|YP_001222959.1| putative thiol-disulfide oxidoreductase [Clavibacter michiganensis subsp. michiganensis NCPPB 382]
    MTFASDDTAGTTVTAEQFRGKVLVVNFWYAECGPCRLEAKDLNKVSEATTDTAAFLGVNTRDSAANADAFVRTFGVPYDT
    VLDVEDNSVQLAFADRTAPNATPSTIVLDPEGRVSARILGLVDPSTLTTLIATAAATPPA

    >gi|148273548|ref|YP_001223108.1| putative molybdenum cofactor biosynthesis protein [Clavibacter michiganensis subsp. michiganensis NCPPB 382]
    MGSSLPLVDLDGTHPGGRGLGGHGSGQDAHERRERHSRHLALPGIGMGGQSRIDQARVLVIGAGGLGSPVLQYLAAAGIG
    TLGIVDDDAVDLSNLQRQTIHGTPDVGRPKTSSAADSVHRTDPGIEVVEHAERLTADNAIRILSGYDVVVDATDNFATRY
    LISDAAALVGVPCVWGSVYRWDAQVTVFWDAAPDGRGIDYRDVFPEPPADGAVLS
    CEEAGVFGAVCGTVGALMATEVIKL
    VTGAGTPLVGRVVVLDALAGTSRTIGVKRAKGRQRVTALADYDLFCGVGAATDGTELDAEEVERILASDEEVVLLDVREP
    DERLVDSIPGHVAVPVRIVTVDPGAVPGAITDRVVVYCASGVRSRAAAAALREAGRDAVSLRGGIQAWRSVAGRA

    >gi|148273556|ref|YP_001223117.1| putative dihydrolipoamide dehydrogenase (E3) component [Clavibacter michiganensis subsp. michiganensis NCPPB 382]
    MPESTDHADPADASPDAPDASDASDASDAPAHYDVAVIGAGPAGTAAALRAAELGASVVVLEAGRVGGTCVNTGCVPTRV
    LAKTARLVREVRSAGENGIGVGEATPHWPSIVARVHEQVDRVRSLKDEAARFEAAGVTLIHEGRARFVDDRTLQLDSGRR
    ITAGSIIVCVGGHSRRLPVPGAELATVPEDVLALPGIPRRLAVIGAGNTGAQLVTVFRSFGSEVTLLDVAPRVLTASDEA
    ISEAVADAFAAQGVRVRTGIDTVTGLTKTGDGSITLLWREGDRPQSSSFDAVIMATGWPADVDDLGLEHAGVEVARSAIP
    VDRYLRTRVPHILAVGDANGKDMLVQAAQSEGEAAAENAVLGVNRRIPLQLLPAGGFTDPDYAGVGLTQAEARERDGACV
    VARVPFAEVDRAVIDDREAGFLLLIADRRRELILGAHAVGENAVEVIQSVTTAMAAGVDVATLAHVRFAYPTYSAIIGIA
    ARRLLQEDDRAGELD

    >gi|148273599|ref|YP_001223160.1| hypothetical protein CMM_2415 [Clavibacter michiganensis subsp. michiganensis NCPPB 382]
    MPNRLADAVSPYLLSHADNPVDWRPWGEEAFAEARRRDVPVLVSVGYSTCHWCHVMARETFSDPALASRLNEGFVAIKVD
    REEHPEVDAALITAAGAFTDQLGWPLNVFTTPEGRTFHAGTYSPPEPRAGHPSFRQVLDAVADAWTTRRDQVEQGAGQLS
    AAIREASERGSVASPLPDAAALDRVAAELASFEDAEHGGFGSAPKFPVAPVVLLLDTLATSGALAPERATSTGALVRRTL
    DAMAGSDLRDPVEGGFFRYSTRRDWSEPHYERMLYDNALLLDAYARAGDEEVAAGIVAFLTGTLRRASGGFASAQDSEST
    VGGRRVEGGYYALDAAGRAAEEPPAVDGKVLTGWNGLAIGALARAGRAFGQGEWIEAARAAADMLLQEHVRSDGSLVRAS
    IDGRVSPAVATLEDHGMLADGLLALALATGEVAYAMRARAIVDALIATAEADPRPGAAGFRVPTGADPVLAGFGLDLASD
    PSEGAYPSGLTAAASAARVFGRLTADPRYERAARAALATVAAGGASRPIAFGGALEQAVAIEAAGRQLVVVVPDGADAAG
    DPLADLARGRIHPPDVSLVVTETAARAWADAGFELLADRAAGSTATAYLCADFVCRLPVTTAEALRAQLADAT

    >gi|148273610|ref|YP_001223171.1| putative thiosulfate sulfurtransferase [Clavibacter michiganensis subsp. michiganensis NCPPB 382]
    MEILITPAELDHALRTRDDVRVLDVRWSLGGPPGRPLHEAGHIPGAVYADLDTELAGHGAPEDGRHPLPATADLQRAARG
    WWIRQGDTVVVHDGGGNTAAARAWWLLRDAGLPDVRILDGALPAWVAAGLPLATGSTVPEPGDVTLTRGALPSLDEDAAA
    GIARSGTLVDARAGERYRGEVEPVDPRAGHIPGAVSAPTTGNLDADGAFLPADALRARFAALGIRPGDVVGVY
    CGSGVTA
    AHEIAALAIAGIDSALYPGSWSAWANRPERPVATGAEPGAGR

    >gi|148273665|ref|YP_001223226.1| putative methionine sulfoxide reductase [Clavibacter michiganensis subsp. michiganensis NCPPB 382]
    MAYEIEKTDDEWRQELSPEEYAVLRQQATERPWTGELLDEERTGVYGCKACGAELFTSDTKFDSHCGWPSFYAPKESDAV
    KLYTDTSLGMKRVEVVCARCGSHLGHVFDDAPQTPTGDRF
    CMNSVSMSFRTAE

    >gi|148274151|ref|YP_001223712.1| putative thioredoxin reductase [Clavibacter michiganensis subsp. michiganensis NCPPB 382]
    MRQIIIIGSGPAGYTAAIYAARANLTPLLIASSVEAGGELMNTTEVENYPGFTDGIQGPDLMMAMQAQAERFGTEVVLDD
    VTSVELTGDVKRVTLGNGDVHEALAVIAATGSAYRKLGLPAEDRFSGHGVSW
    CATCDGFFFRQKTIAVVGGGDSAMEEAT
    FLTRFAEKVYVIHRKDTLRASKIMQDRAFENPKIEFVWNAQVVDITGGEKVEGVVLEDTVTGEQRPLAVEGLFIAIGNDP
    RTHLFHQQLELTTEGTIAVDGRSSRTNLPGVFAAGDVIDPTYRQAVTAAASGTVAALDAEHFLASLPDTLLDAASDGPDG
    PAGHGAPAAGSAVDPDGELVGADHQ

    >gi|148274152|ref|YP_001223713.1| putative thioredoxin [Clavibacter michiganensis subsp. michiganensis NCPPB 382]
    MSHSRDVTDASFQADVLDAEKTVIVDFWAPWCGPCKAVSPVLDQIAAENPGIELVKIDVDDNPEIAMKYKITSIPAMKVF
    QKGEVVKTVIGAKPKPALEQEFADFLK