Citrobacter rodentium ICC168 uid43089

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|283783808|ref|YP_003363673.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Citrobacter rodentium ICC168]
    MQILLANPRGFCAGVDRAISIVENALAIYGAPIYVRHEVVHNRYVVDSLRERGAIFIEQISEVPDGAILIFSAHGVSQAV
    RNEAKSRDLTVFDAT
    CPLVTKVHMEVARASRRGEESILIGHAGHPEVEGTMGQYSNPEGGMYLVESPEDVWTLNVKNEGK
    LSFMTQTTLSVDDTSDVIDALRQRFPKIVGPRKDDICYATTNRQEAVRRLAEQADVVLVVGSKNSSNSNRLAELAQRMGK
    TAFLIDDATDIQEAWVKEAKCVGVTAGASAPDILVQNVITRLQALGGGEAIPLEGREENIVFEVPKELRMDVREIG

    >gi|283783903|ref|YP_003363768.1| dihydrolipoyl dehydrogenase (E3 component of pyruvate and 2-oxoglutarate dehydrogenase complexes) [Citrobacter rodentium ICC168]
    MSTEIKTQVVVLGAGPAGYSAAFRCADLGLETVIVERYNTLGGVCLNVGCIPSKALLHVAKVIEEAKALAEHGIVFGEPK
    TDIDKIRTWKEKVITQLTGGLAGMAKGRKVKVVNGLGKFTGANTLEVEGENGKTVINFDNAIIAAGSRPIQLPFIPHEDP
    RVWDSTDALELKEVPKRMLVMGGGIIGLEMGTVYHALGSEIDVVEMFDQVIPAADKDIVKVFTKRISKKFNLMLETKVTA
    VEAKEDGIYVSMEGKKAPAEAQRYDAVLVAIGRVPNGKNLDAGKAGVEVDDRGFIRVDKQLRTNVPHIFAIGDIVGQPML
    AHKGVHEGHVAAEVIAGKKHYFDPKVIPSIAYTEPEVAWVGLTEKEAKEKGISYETATFPWAASGRAIASDCADGMTKLI
    FDKESHRVIGGAIVGTNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEVFEGSITDLPNPKAKKK

    >gi|283783941|ref|YP_003363806.1| hypothetical protein ROD_01601 [Citrobacter rodentium ICC168]
    MSDDVALPLQFTEAAANKVKSLIADEDNPNLKLRVYITGGGCSGFQYGFTFDDQVNEGDMTIEKQGVGLVVDPMSLQYLV
    GGSVDYTEGLEGSRFVVTNPNAKSTCGCGSSFSI

    >gi|283784221|ref|YP_003364086.1| probable peroxidase [Citrobacter rodentium ICC168]
    MVLVTRQAPDFTAAAVLGSGEIVENFNFKQHTNGKATVLFFWPMDFTFVCPSELIAFDKRYEEFQKRGVEVVGVSFDSEF
    VHNAWRNTPVDKGGIGAVKYAMVADVKREIQKAYGIEHPEAGVALRGSFLIDANGIVRHQVVNDLPLGRNIDEMLRMVDA
    LQFHEEHGEVCPAQWEKGKEGMNASPDGVAKYLTENVSSL

    >gi|283784310|ref|YP_003364175.1| copper-transporting P-type ATPase [Citrobacter rodentium ICC168]
    MSQTIDLTLDGLSCGHCVKRVKESLEQRPDVEQAEVSITQAHVTGTASADALIETIKQAGYGAELSHPKAKPLAESSIPS
    EALAAVPDELPAAAAEEDSQQLLLSGMS
    CASCVTRVQNALQSVPGVTQARVNLAERTALVMGSASATDLVQAVENAGYGA
    EAIEDDVKRRERQQETAIATMKRFRWQAIVALLLGVPVMVWGMIGDNMMVTADNRSLWLAIGLATLAVMVFAGGHFYRSA
    WKSLMNGTATMDTLVALGTGVAWLYSMSVNLWPQWFPMEARHLYYEASAMIIGLINLGHMLEARARQRSSKALEKLLDLT
    PPTARVVTDSGDKSVPLAEVQPGMLLRLTTGDRVPVDGEITQGEAWLDEAMLTGEPLPQQKGAGDSVHAGTVVQDGSVLF
    RASAVGSHTTLSRIIRMVRQAQSSKPQIGQLADKISAVFVPVVVVIALVSAGIWYFFGPAPQIVYTLVIATTVLIIACPC
    ALGLATPMSIISGVGRAAEFGVLVRDADALQRASTLDTVVFDKTGTLTEGKPQVVAIKTFAGVDEAQALRLAAALEQGSS
    HPLARAILDKAGDITLPQVNGFRTLRGLGVSGEAEGHTLLLGNQALLNEQQVATTEMEAEIAAQASQGATPVLLAIDGTA
    AALLAVRDPLRSDSVAALQRLHRAGYRLVMLTGDNPTTANAIAKEAGIDEVIAGVLPDGKADAIQRLQSQGRQVAMVGDG
    INDAPALAQADVGIAMGGGSDVAIETAAITLMRHSLLGVADALSLSRATLRNMKQNLLGAFIYNSIGIPVAAGILWPFTG
    TLLNPVVAGAAMALSSITVVSNANRLLRFKPKE

    >gi|283784316|ref|YP_003364181.1| thioredoxin-like protein [Citrobacter rodentium ICC168]
    MSVQNIVNINESNLQQTLEQSMTTPVLFYFWSERSQHCLQLTPVLESLATQYNGQFILAKLDCDAEQMIAAQFGLRAIPT
    VYLFQNGQPVDGFQGPQPEEAIRALLDKVLPREEELKAQQAMQLMQEGNYIEALPLLKEAWQLSNQNSEIGLLLAETQIA
    LNRSEDAEAVLKTVPLQDQDTRYQGLVAQIDLLKQAADTPEIQQLQQQVADNPQDAGLAAQLALQLHQVGRNEEALELLF
    SHLRKDLAAGDGQVRKMFQEILAALGTGDALASKYRRQLYALLY

    >gi|283784376|ref|YP_003364241.1| thiol:disulfide interchange protein [Citrobacter rodentium ICC168]
    MLKRTLLLALLPFGAYAEELPAPVKAIEQQGITIIKSFDAPGGMKGYLGKYQDMGVTIYLTPDGKQAISGYMYNEKGDNL
    SNQLIEKEIYAPAGRELWQRMEKASWLLEGSKEAPVVLYVFADPF
    CPYCKQFWQQARPWVESGKVQLRTLLVGVIKPESP
    ATAAAILAAKDPAKAWRDYENSAGKMTLNVPASIDARYKETLNHNEKIMDDLGANVTPAIYYMSRENTLQQVIGLPDKQQ
    LAAMMESH

    >gi|283784377|ref|YP_003364242.1| alkyl hydroperoxide reductase subunit C [Citrobacter rodentium ICC168]
    MSLINTKIKPFKNQAFKNGEFIEVTEKDTEGRWSVFFFYPADFTFVCPTELGDVADHYEELQKLGVDVYSVSTDTHFTHK
    AWHSSSETIAKIKYAMIGDPTGALTRNFDNMREDEGLADRATFVVDPQGIIQAIEVTAEGIGRDASDLLRKIKAAQYVAA
    HPGEVCPAKWKEGEATLAPSLDLVGKI

    >gi|283784378|ref|YP_003364243.1| alkyl hydroperoxide reductase subunit F [Citrobacter rodentium ICC168]
    MLDTNMKTQLKAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSPKVTFKEENSLPVRKPSFLITNPGSDRGPRFAG
    SPLGHEFTSLVLALLWTGGHPSKETQSLLEQIRDIDGDFEFETYYSLS
    CHNCPDVVQALNLMAVLNPRIKHTAIDGGTFQ
    NEITDRNVMGVPAVFVNGKEFGQGRMTLAEIVAKVDTGAEKRAAEELNKRDAYDVLIVGSGPAGAAAAVYSARKGIRTGL
    MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVSDYDVDVIDSQSASRLVPAAVEGGLHQIETASGAVLKARSIII
    ATGAKWRNMNVPGEDQYRTKGVTY
    CPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKI
    RSLKNVDIILNAQTTEVKGDGSKVVGLEYRDRVSGDIHNVELAGIFVQIGLLPNTNWLEGAIERNRMGEIIIDAKCETSV
    KGVFAAGDCTTVPYKQIIIATGEGAKASLSSFDYLIRTKTA

    >gi|283784590|ref|YP_003364455.1| molybdopterin biosynthesis protein [Citrobacter rodentium ICC168]
    MAELSDQEMLRYNRQIILRGFDFDGQEALKAAKVLIVGLGGLGCAASQYLASAGVGQLTLLDFDTVSLSNLQRQTLHSDT
    TVGQAKVDSARDALRRINPYIAITPVNALLDDAALAALIAEHDLVLDCTDNVAVRNQLNAGCFAAKVPLVSGAAIRMEGQ
    ISVFTYQEGEPCYRCLSRLFGDNALT
    CVEAGVMAPLIGVIGSLQAMEAIKLLAQYGQPARGKIVIYDAMTCQFREMKLMR
    NPNCEVCGE

    >gi|283784613|ref|YP_003364478.1| glutaredoxin 1 [Citrobacter rodentium ICC168]
    MKEKQMFTVIFGRPGCPYCVRAKELAEKLSNERDDFNYRYIDIHAEGITKADLEKTVGKPVETVPQIFVDQQHIGGYTDF
    EAWAKENLNLFA

    >gi|283784710|ref|YP_003364575.1| thioredoxin reductase [Citrobacter rodentium ICC168]
    MGTTKHSKLLILGSGPAGYTAAVYAARANLQPVLITGMEKGGQLTTTTEVENWPGDPNDLTGPLLMERMHEHATKFETEI
    IFDHINKVDLQNRPFRLTGDSAEYTCDALIIATGASARYLGLPSEEAFKGRGVSA
    CATCDGFFYRNQKVAVIGGGNTAVE
    EALYLANIASEVHLIHRRDTFRAEKILIKRLMDKVENGNIVLHTHRTLEEVTGDQMGVTGLRLRDTQNADNIEALDVAGL
    FVAIGHSPTTAIFEGQLELENGYIKVQSGIHGNATQTSVPGVFAAGDVMDHIYRQAITSAGTGCMAALDAERYLDGLADA
    CK

    >gi|283784851|ref|YP_003364716.1| rhodanase-like protein [Citrobacter rodentium ICC168]
    MPVLHNRISNDLLKARMLAETEPRTTISFYKYFTIANPQAARDALYQRFSALNVFGRVYLAQEGINAQISVPQSQLDNFR
    QQLYAFDPALDGLRLNIALDDDGKSFWVLRMKVRDRIVADGIDDPRFDASNVGDYLQAAEVNAMLDDPDAVFIDMRNHYE
    YEVGHFENALEIPADTFREQLPKAIEMMQEHKDKKIVMY
    CTGGIRCEKASAWMKHNGFNKVWHIEGGIIEYARRAREQGL
    PVRFIGKNFVFDERMGERISEEVIAHCHQCGAPCDSHTNCKNDGCHLLFIQCPACAEKFTGCCSELCCEELELPEEEQRR
    RRAGRENGNKIFNKSRGRLNTVLGIPDPAE

    >gi|283784861|ref|YP_003364726.1| glutaredoxin 2 [Citrobacter rodentium ICC168]
    MKLYIYDHCPFCVKARMIFGLKNIPVELNVLANDDADTPTRMVGQKMVPILQKDDSRYMAESMDIVHYVDKSDGKPLLTG
    KQNPAIAEWLRKVNGYANQLLLPRFAQSAFDEFSTPSARRYFIDKKEATIGSFADHLAHSAGLTKKISDDLRALDKLIVQ
    PNAVNGELSEDDFQLFPLLRNLTLVSGVTWPTRVADYRDNMAKQTQVNLLSSMAI

    >gi|283784924|ref|YP_003364789.1| hypothetical protein ROD_11981 [Citrobacter rodentium ICC168]
    MGHPSVYPTGATLYDPQRAWSGYTLFQAAGHGAVLVDMNGCVVREWPELHGFPNKILPGGAILGHSGERDPRYGMQDMLD
    LIQVDWEGNITWQFDRYEQISDPGSETRWMARAHHDYQRAGNPVGYYAPGLEPQVTGGNTLILAHTNLINEAISDKLLLD
    DTIIEVDWQGNVVWEWRCSDHFHELGFDDAARTALYNNPNMRASGGGMGDWMHINSMSALGPNKWYDAGDQRFHPDNIIW
    DARESNIIAIIDKQSGKIVWQLGPDYSKPELKHIGWIIGQHHAHLIPQGLPGAGNILIFDNGGWAGYGAPNPASADGIKN
    AWRDYSRVLEINPITLDIEWRYSPYEADLPQPTDSYRFYSPYISNMQRLENGNTLINEGSNGRIFEVTRDHEIVWEYISP
    FWGKTLNNNMVYRAYRIPYFWIPQLTQPQETPIAAVDVRTLRQPSAAAAGPAQSVVRVAGVQPYSKNADALCVATDNDTL
    RRSPKLFQVAESAFRPVNAASELESERPVLLFVGAER
    CVHCRKLWQLLAHEQLQSPLAALDTCYLDADRNQELAAALGVR
    GLPTLLVLKHGQPAQRGPQTLSLEALAGWLKNVEGEQQK

    >gi|283784996|ref|YP_003364861.1| peptide methionine sulfoxide reductase [Citrobacter rodentium ICC168]
    MSEMQFYVTQNHGTEPPFTGQLLHNKRDGVYHCLICDAPLFTSRSKYDSGCGWPSFYEPVSDEAIRYLNDDSHGMQRIEI
    RCGNCDAHLGHVFPDGPQPTGERY
    CVNSASLSFTDDENGEQIQG

    >gi|283785014|ref|YP_003364879.1| Selenide,water dikinase [Citrobacter rodentium ICC168]
    MSEHAIRLTQYSHGAGCGCKISPKVLETILHSEQAKFVDPNLLVGNETRDDAAVYDLGNGTSVISTTDFFMPIVDNPFDF
    GRIAATNAISDIFAMGGKPIMAIAILGWPVSKLSPEIAREVTEGGRFACRQAGIALAGGHSIDAPEPIFGLAVTGVVPTE
    RVKKNSTAQAGCKLFLTKPLGIGVLTTAGKKSLLKPEHQGLATEVMCRMNIAGAAFAEIDGVKAMTDVTGFGLLGHLSEM
    CQGAGVQAQIDYQAVPKLPGVEEYIRLGAVPGGTERNFASYGHLMGEMPREVRDLLCDPQTSGGLLLAVTPEAVAEVQAA
    AAKFAIDLTAIGELVEARGGRVMVEIR

    >gi|283785020|ref|YP_003364885.1| putative decarboxylase [Citrobacter rodentium ICC168]
    MSDQKSRESSLNDPQPWVKPLTRLPSGLKPLTMAQKKHYGEVLHPTRWWGRMPFLFWLVALFVGFLERRRARLTPEMRAL
    LMSRVSQACHCAF
    CIDANSLRLAERCGAMDKVLAVAQWQTSALFSAQERVALAYADAVTATPPQVDEALKAQMKQHFSDD
    EISEMTALLAFQNLSVRFNAALDIPSQGLCDSQKGAPRA

    >gi|283785022|ref|YP_003364887.1| putative thiosulfate sulfurtransferase [Citrobacter rodentium ICC168]
    MKRVSQMTALAMALGLACASSWAEDMAQALNFTQLQQQHGTAIDTRQSAFYNGWPQSLNGPSGHEPSALNLSASWLDKMS
    DQQLDNWLKQHQIKTDTPVALYGSNGDIQAVKTRLRQAGLQQIATLSDALQTPAHLQRLAHFEQLVYPQWLHDLQQGKAV
    TAKPAGDWKVIEVAWGAPKFYLLSHIPGASYIDTNEVESEPLWNKVSDADLKAMLAKHGIRHDTTMILYGRDVYAAARVA
    QIMLYAGVKDVRLLDGGWQSWSDAGLPVERGTPTQVKPETDFGATIPAQPQLMLNTEQARGLLHRQDASLVSIRSWPEFI
    GVTSGYSYIKPKGEIAGARWGHAGSDSTHMEDFHNPDGTMRSADDIAAMWKQWNILPDQQVAFY
    CGTGWRASETFMYARA
    MGWQNVAVYDGGWYEWSRDPKNPVARGERGPQSSL

    >gi|283785066|ref|YP_003364931.1| vitamin B12 transport periplasmic protein (putative glutathione peroxidase) [Citrobacter rodentium ICC168]
    MQDSILNTEVTTIDGDVITLDKYAGKVLLIVNVASKCGLTPQYEQLENIQKAWADRGFVVLGFPCNQFLGQEPGSDEEIK
    TWCSATWGVTFPMFSKIDVNGEGRHPLYQKLIAAAPTAVAPENSGFYERMASKGRAPLYPDDILWNFEKFLVGRDGNVVQ
    RFSPDMTPEDPIVMESIKIALAK

    >gi|283785070|ref|YP_003364935.1| hypothetical protein ROD_13491 [Citrobacter rodentium ICC168]
    MTLSFTARWRDELPATYTALSPTPLKNARLIWHNSALAQQLNIPQTLFDADGPAGVWGGESLLPGMSPLAQVYSGHQFGV
    WAGQLGDGRGILLGEQALPDGSILDWHLKGAGLTPYSRMGDGRAVLRSTIRESLASEAMHYLGIPTTRALTIVTSDTPVY
    RETVESGAMLMRLAQSHMRFGHFEHFYYRREPEKVQQLADFAIRHYWPHLHEETDKYLLWFRDVVARTATLIADWQTVGF
    AHGVMNTDNMSILGLTMDYGPFGFLDDYEPGFICNHSDHQGRYRFDNQPAVGLWNLQRLAQSLSPFIGVEALNNALDEYQ
    QELLRRYGQRMRQKLGFISEQKEDNELLNALFSLMARERSDYTRTFRMLSRTEQQSAASPLRDEFIDRAAFDAWFARYRE
    RLLRDGVDDAARQMLMLSVNPALVLRNWLAQRAISAADQGDMSELHRLHAALRDPFTDRSDDYVNRPPDWGRHLEVS
    CSS


    >gi|283785086|ref|YP_003364951.1| Fe-S cluster assembly protein [Citrobacter rodentium ICC168]
    MRGNLMELHSGTFNPDDFAWRGLTLTPAAAAHIRELVAKQPGMLGVRLGVKQTGCAGFGYVLDSVREPQQDDLLFESDGA
    KLYVPLQAMPFIDGTEVDYVQEGLNQLFKFHNPKAQNECGCGESFGV

    >gi|283785134|ref|YP_003364999.1| hypothetical protein ROD_14161 [Citrobacter rodentium ICC168]
    MTTTIEKIQRQIAENPILLYMKGSPKLPSCGFSAQAVQALSACGERFAYVDILQNPDIRAELPKYANWPTFPQLWVDGEL
    VGGCDILIEMYQRGELQQLIKETAAKYKTEESGNE

    >gi|283785153|ref|YP_003365018.1| electron transport complex protein [Citrobacter rodentium ICC168]
    MSEIKDVIVQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLMLTLTNFTVSALRRWTPAEIRIPIYVMIIASVV
    SAVQMLINAFAFGLYQSLGIFIPLIVTN
    CIVVGRAEAFAAKKGPLLSALDGFSIGMGATGAMFVLGSLREILGNGTLFDG
    ADGLLGSWAKALRVEIFHTDSPFLLAMLPPGAFIGLGMMLAIKYLIDEKMKKRRASAATAAELPSGEPGNAS

    >gi|283785158|ref|YP_003365023.1| electron transport complex protein [Citrobacter rodentium ICC168]
    MTDYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAMGMGLATTFVLTLASICAWLIDTWILIPLNLIYLRTLAFILV
    IAVVVQFTEMVVRKTSPALYRLLGIFLPLITTN
    CAVLGVALLNINLGHNFLQSALYGFSAAVGFSLVMVLFAAIRERLAV
    ADVPAPFRGNAIALITAGLMSLAFMGFSGLVKL

    >gi|283785269|ref|YP_003365134.1| peroxiredoxin (osmotically-inducible protein C) [Citrobacter rodentium ICC168]
    MTIHKKGQAHWEGDIKRGKGTVSTESGVLSQQPYGFNTRFEGEKGTNPEELIGAAHAACFSMALSLMLGEAGFTPDAIDT
    TADVSLDKVDAGFAITKIALHSEVKVPGIDANTFDGIIQKAKAG
    CPVSQVLKAEITLDYQLNA

    >gi|283785374|ref|YP_003365239.1| methylated-DNA-protein-cysteine methyltransferase [Citrobacter rodentium ICC168]
    MLTLLEDKIATPLGPLWVICDEQFRLRAVEWEQHSDRMEQLLDIHYRAEGYIRVAAKNPGGLSDKLNDYFSGNIQVIDTL
    PTATGGTPFQREVWQMLRSIPCGQVMHYGQMAEQLGRPGAARAVGAANGSNPISIVVP
    CHRVIGRNGTMTGYAGGVQRKE
    WLLRHEGYLLL

    >gi|283785381|ref|YP_003365246.1| thiol peroxidase [Citrobacter rodentium ICC168]
    MSQTVHFQGNPVAVANAIPQAGSKAQPFTLVAKDLSDVALSQFAGKRKVLNIFPSIDTGVCAASVRKFNQLATELENTVV
    LCVSADLPFAQSRFCGAEGLSNVITLSTLRNAEFLKNYGVEITEGPLKGLAARAVVVIDENDNVIFSQLVDEITTEPDYA
    AALDVLKA

    >gi|283785491|ref|YP_003365356.1| hypothetical protein ROD_17931 [Citrobacter rodentium ICC168]
    MQKIVIVANGAAYGSESLFNSLRLAIALREQTGDLDLRLFLMSDAVTAGLRGQKPAEGYNIQQMLEILTAQNVPVKLCKT
    CTDGRGITDLPLIDGVAVGTLVELAQWTLAADKVLTF

    >gi|283785531|ref|YP_003365396.1| Disulfide bond formation protein B [Citrobacter rodentium ICC168]
    MLRYLNQCSRGRGAWLLMAFTALALEMVALWFQHVMMLKPCVLCIYERCALFGVLGAGLVGAIAPKTPLRYVALVIWIYS
    AWRGIQLAWEHTQIQLHPSPFMT
    CDFMARFPSWLPLDKWLPQVFVASGDCAERQWSFLTLEMPQWLLGIFVAYLVVAVLV
    LIAQPLKPKRRDLFGR

    >gi|283785703|ref|YP_003365568.1| hypothetical protein ROD_20131 [Citrobacter rodentium ICC168]
    MSWQQFKQAWLIKFWAPIPAVIAAGILSTYYFGITGTFWAVTGEFTRWGGEILQLFGVHAEEWGYYKLIHLEGTPLTRID
    GMMILGMFGGCFAAALWANNVKLRMPRSRVRIMQAVIGGMIAGFGARLAMG
    CNLAAFFTGIPQFSLHAWFFALATAIGSW
    FGARFTLLPVFRIPVKMQKVSAASPLTQKPDQARRRFRLGMLVFAGMIGWALLTAMNQPKLGLAMLFGVGFGLLIERAQI
    CFTSAFRDLWITGRTQMAKAIIFGMAVSAIGIFSYVQLGVEAKIMWAGPNAVIGGLLFGFGIVLAGGCETGWMYRAVEGQ
    VHYWWVGLGNVIGSTILAYYWDDFAPTLATHWDKINLLNAFGPLGGLLVTYLLLFTALMLIIGWEKRFFRRAGLTLAKES
    A

    >gi|283785835|ref|YP_003365700.1| hypothetical protein ROD_21521 [Citrobacter rodentium ICC168]
    MLSMIISGLFCGALLGFVMQRGRFCLTGGFRDMYIAKNNRMFYALLIAIAVQSVGVFTLIQAGVLSYDAGAFPWLGTVVG
    GYIFGIGIVYAGG
    CATGTWYRAGEGLIGSWIALFTYMVMSAVMRSPHASGLNQTLKAYSTEHNSIADTLNISVWPLIAIL
    LAVTLWVVAKELKKPKLKVATLPPRRSGLAHLLFEKRWHPFVTAVLIGLIALLAWPLSEATGRMFGLGITSPTANILQFL
    VAGDSKFLNWGVFLVLGIFLGSFIAAKASREFRVRAADAATTLRSGFGGILMGFGASIAGG
    CSIGNGLVMTAMMTWQGWV
    GLAFMILGVWTASWIVYVRPQRKARLTTAAAN

    >gi|283786006|ref|YP_003365871.1| thiol:disulfide interchange protein (cytochrome C-type biogenesis protein) [Citrobacter rodentium ICC168]
    MKRNVLLIPLIIFLLIAAALLWQLARNAEGDTPTNLESALIGKPVPTFRLESLENPGKYYEADVLTQGKPVLLNVWATWC
    PTCRAEHQYLNQLSAQGIRVVGMNYKDDRQQAIVWLKELGNPYDLSLFDGDGMLGLDLGVYGAPETFLIDGKGIIRYRHA
    GDLNAQVWESEIRPLWEKYSKEAAQ

    >gi|283786026|ref|YP_003365891.1| regulatory protein of adaptative response [contains: methylated-DNA--protein-cysteine methyltransferase] [Citrobacter rodentium ICC168]
    MKPNLSVTDDERWQSVLARNPAADGQFVFAVRTTGIFCRPSCSAKHALRKNVRFFPDARTALAAGFRPCKRCQPDKAHPQ
    QHRLDKITLACQLLEQDEPIALAALAQQVAMSPYHFHRLFKAATGMTPKAWQQASRARRLRDALNGGDSVTQAILNAGLP
    DSSSYYRHADSALGMTAKQFRRGGDRLAVRYTLADCSLGRCLVAESERGICAILLGDDDASLIAGLHSLFPAAQDEPADE
    AFRQRVAQVIASIDGRDVPLVLPLDIQGTAFQQQVWQALRAIPGGETVSYQQLAAKIGKPNAARAVASACGANKLAVVIP
    CHRVVRGDGALSGYRWGVARKAQLLRRESSGKES

    >gi|283786094|ref|YP_003365959.1| putative glutaredoxin [Citrobacter rodentium ICC168]
    MITLYGIKNCDTIKKARRWLEAQNIEYRFHDYRVDGLDNALLNTFINELGWEALLNTRGTTWRKLDEATRSSVTDAASAA
    ALMVEMPAMIKRPLLCAPGKPMLLGFSESSYQQFFDEV

    >gi|283786104|ref|YP_003365969.1| putative peroxiredoxin (bacterioferritin comigratory protein) [Citrobacter rodentium ICC168]
    MNPLKAGDIAPKFSLPDQDGEQVNLTDFQGQRVLVYFYPKAMTPGCTVQACGLRDNMDELKKAGVDVLGISTDKPEKLSR
    FAEKELLNFTLLSDEDHQVCEQFGVWGEKSFMGKTYDGIHRISFLIDADGKVEHVFDDFKTSNHHDVVLNWLKENA

    >gi|283786111|ref|YP_003365976.1| putative glutaredoxin [Citrobacter rodentium ICC168]
    MSEAVKIYHNPRCSKSRETLSLLQANGVEPEVVLYLETPADAATLRQLLQMLGMTSARELMRQKEDLYKELNLADEKLTE
    DDLIQAMVENPKLMERPIVVANGQARIGRPPEQVLDIIR

    >gi|283786136|ref|YP_003366001.1| 3-mercaptopyruvate sulfurtransferase [Citrobacter rodentium ICC168]
    MSTAWFVAADWLAEHIDDPQIQIIDARMAPPGQEDRDVAQEYRSGHIPGALFFDIEALSDHTSPLPHMMPRPEAFAVAMR
    ELGVQQDKHLIVYDEGNLFSAPRAWWMLRAFGVGNVSILGGGLAGWQRDGLPLEEGDAERREGEFDAAFTPEAVVRVTDV
    LLASHEKTAQIVDARPAARFNAEMDEPRPGLRRGHIPGALNVPWTELVQNGELKTTDELDAIFFRHGVSLDRPIIAS
    CGS
    GVTAAVVVLALATLEVPDVSLYDGAWSEWGARADLPVEPAQSE

    >gi|283786143|ref|YP_003366008.1| iron-binding protein (iron-sulfur cluster assembly protein) [Citrobacter rodentium ICC168]
    MSITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPAAEDTVFEDKGVKVVVDGKSLQFLDGTQLDFV
    KEGLNEGFKFTNPNVKDECGCGESFHV

    >gi|283786197|ref|YP_003366062.1| thioredoxin 2 [Citrobacter rodentium ICC168]
    MLFKTASSIICNILETNWRIRRTLSLLIPRLVMNTVCSSCQAINRIPDDRVEDAAKCGRCGHDLFDGEVINATGETLDKL
    LKDDLPVVIDFWAPW
    CGPCRNFAPIFEDVAEERSGKVRFVKVNTEAERELSARFGIRSIPTIMIFKNGQVVDMLNGAVPK
    APFDSWLNESL

    >gi|283786772|ref|YP_003366637.1| glutaredoxin-like protein [Citrobacter rodentium ICC168]
    MEIRIMRIIIYTRNDCVQCHATRRALESRGFEFETVNVDLLPEAAETLRARGFRQLPVVIAGDISWSGFRPDMINRLPVE
    PRVARA

    >gi|283786818|ref|YP_003366683.1| thiol:disulfide interchange protein [Citrobacter rodentium ICC168]
    MAQRILTLILLLCSASSFAGLFDAPGRSNFVPADQAFAFDFQQNQHNLNLNWQIKDGYYLYRKQIRVTPAQAQIDTLALP
    AGVWHEDEFYGKSEIYRQRLTIPVIVQQAAAGATLTVTYQGCADAGFCYPPETRTVPLSEVVASATSQSAATPAPVAVQP
    AGQPPAQLPFSALWALLIGIGIAFTPCVLPMYPLISGIVLGGKQRLSSGRALLLTFIYVQGMALTYTALGLVVAAAGLQF
    QAALQHPWVLITLAAVFTLLALSMFGLFTLQLPSALQTRLTLMSNRQQGGSAGGVFAMGAIAGLICSPCTTAPLSAILLY
    IAQSGNLWLGGGTLYLYALGMGLPLMLVTIFGNRLLPKSGPWMEHVKTAFGFVILALPVFLLERIIGDVWGMRLWSLLGV
    AFFGWAFITSLQARRGWMRIVQIILLAAALVSVRPLQDWTFGASPVQSQTHLSFKQVTNIDELNQALAEASGKPVMLDLY
    ADW
    CVACKEFEKYTFSDPQVKQALGDTVLLQANVTANNAQDVALLKHLQVLGLPTILFFDAQGHEHPQARVTGFMDAATF
    SAHLRDRQP

    >gi|283786897|ref|YP_003366762.1| peptide methionine sulfoxide reductase [Citrobacter rodentium ICC168]
    MSLFDKKHLISPSDALPGRNTPMPVATLHAVNEHSMTNVPEGMEIAIFAMGCFWGVERLFWQLPGVYSTAAGYTGGYTPN
    PTYREVCTGETGHAEAVRVVYDPKVISYEQLLQVFWENHDPAQGMRQGNDHGTQYRSAIYPLTPEQEAAARASAERFQAA
    MTAAGDDRVITTEISSARPFYYAEDDHQQYLHKNPYGYCGIGGIGVCLPPQS

    >gi|283787098|ref|YP_003366963.1| putative thiol:disulfide interchange protein [Citrobacter rodentium ICC168]
    MATHFKRITIISYSLFLIVISSLMTVLCYHIFVFKTFAADDGQTQAFREVSAEYVANSPIKEQRSIVEVMSYGCHYCAAN
    EDNLAEFARSLPPGSTFTSIHIAGNDSGLAAWAPIFATLEEMGIEKTVRDSAYNAVITRNVNLADEKTLADWLAKNNIDT
    AKFNALRQSDAVKKRLSEMAAITTHYNINATPIFIINKRYVVAQDRDFPQFAERMLQLLKEER

    >gi|283787172|ref|YP_003367037.1| thiol:disulfide interchange protein [Citrobacter rodentium ICC168]
    MSAKWINSIFKSVVLTAALALPFTASAFTEGTDYMVLEKPIPDADKTLIKVFSYACPFCYKYDKAVTGPVADKVADLVTF
    VPFHLETKGEYGKQASELFAVTMAKDKAAGVSLFDEKSQFKKAKFAWYAAYHDKKERWSDGKDPAAFLKTGLDAAGMSQA
    EFEAALKEPTVQQTLQKWKAAYEVAKIQGVPAYVVNGKYLIYTKNIKSIDSMAQLVRELATK

    >gi|283787173|ref|YP_003367038.1| putative disulfide bond formation protein [Citrobacter rodentium ICC168]
    MVDIKGMWKDLRATPVETLVRWQEQRFLWLLMAVAMGGLIILAHSFFQIYLYMAPCEQCVYIRFAMFVMVFGGLIAAINP
    KNIILKLIGCLAAFYGSIMGIKFSVKLNGIHYAVHNPDPDALFGVQG
    CSTDPTFPFGLPLAEWAPEWFRPTGDCGYDAPV
    VPDGVTLSSVQQWFVEMYQHSEGWYLIPPWHFMNMAQACLLAFGLCFALLLIMSGAWAIKLIKAK

    >gi|283787335|ref|YP_003367200.1| adenylyltransferase [Citrobacter rodentium ICC168]
    MNDRDFMRYSRQILLGDIAIEGQQALLESRALIIGLGGLGSPTALYLAAAGVGTLVLADDDAVHISNLQRQILFTTEDLA
    RPKSQAAQQRLSRLNPQIELVALPQRLNGDALNQAVAQADVVLDCTDNMATRQEINAVCVAHNTPLITASAVGFGGQLMV
    LTPPWEQGCYRCLWPDDSEPERN
    CRTAGVLGPVVGVMGTLQALEAIKLLSGIETPAGELRLFDGKTSQWRTLALRRATGC
    PVCGGQHANPV

    >gi|283787357|ref|YP_003367222.1| soluble pyridine nucleotide transhydrogenase [Citrobacter rodentium ICC168]
    MPHSWDYDAIVIGSGPGGEGAAMGLVKQGARVAVIERYHNVGGGCTHWGTIPSKALRHAVSRIIEFNQNPLYSDHSRLLR
    SSFADILNHADNVINQQTRMRQGFYERNHCEILQGNAHFVDEHTLALECSDGTVETLTAEKFVIACGSRPYHPADVDFSH
    PRIYDSDSILSLHHEPRHVIIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAFLDQEMSDSLSYHFWNSGVVIRHNEEY
    EKIEGCDDGVIMHLKSGKKLKADCLLYANGRTGNTDSLALQNIGLETDSRGQLKVNSMYQTALPHVYAVGDVIGYPSLAS
    AAYDQGRIAAQALVKGEATAHLIEDIPTGIYTIPEISSVGKTEQQLTAMKVPYEVGRAQFKHLARAQIVGMNVGTLKILF
    HRETKEILGIHCFGERAAEIIHIGQAIMEQKGGGNTIEYFVNTTFNYPTMAEAYRVAVLNGLNRLF

    >gi|283787472|ref|YP_003367337.1| thiol:disulfide interchange protein [Citrobacter rodentium ICC168]
    MKKIWLALAGMVLAFSASAAQFEDGKQYTTLEKPVAGEPQVLEFFSFYCPHCYQFEEVLHVSDNVRKKLPEGVKMTKYHV
    EFLGPLGKEMTQAWAVAMALGVEDKVTVPMFEGVQKTQTIQSVADIRKVFVDAGVKGEEYDAAWNSFVVKSLVAQQEKAA
    ADLQLQGVPAMFVNGKYQVNPQGMDTSSMDIFVQQYADTVKYLVSKK

    >gi|283787537|ref|YP_003367402.1| thioredoxin 1 [Citrobacter rodentium ICC168]
    MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLL
    LFRNGEVAATKVGALSKGQLKEFLDANIA

    >gi|283787756|ref|YP_003367621.1| putative rhodanase-like exported protein [Citrobacter rodentium ICC168]
    MQEIMQFVGRHPILSIAWIALLVAVLFTTFKGLTSKVKVITRGEATRLINKEDAIVVDLRQRDDFRKGHIAGAVNLLPGE
    IKANNVGELEKHKDKPIIVVDASGMQ
    CQEAANALIKAGFEKVSVLKEGVAGWSGENLPLVRGK

    >gi|283787757|ref|YP_003367622.1| glutaredoxin 3 [Citrobacter rodentium ICC168]
    MANIEIYTKATCPFCHRAKALLNSKGVSFQELPIDGDAVKREEMIKRSGRTTVPQIFIDAQHIGGCDDLYALDARGGLDP
    LLS

    >gi|283787845|ref|YP_003367710.1| glutathione reductase [Citrobacter rodentium ICC168]
    MSKHYDYIAIGGGSGGIASINRAAMYGQKCALIEAKELGGTCVNVGCVPKKVMWHAAQIREAIHLYGPDYGFDTTINTFN
    WQTLIASRTAYIDRIHTSYDNVLGKNNVDVIRGFARFVDAKTIEVNGETLTADHILIATGGRPSHPDIPGVEYGIDSDGF
    FELPALPERVAVVGAGYIAVELAGVINGLGAKTHLFVRKHAPLRSFDPMISETLVEVMNAEGPQLHTHAIPKAVVKNADG
    SLTLELEDGRSETVDCLIWAIGREPATDNFNLAATGVKTNEKGYIIVDKYQNTNVEGIYAVGDNTGAVELTPVAVAAGRR
    LSERLFNNKPDEHLDYSNIPTVVFSHPPIGTVGLTEPQAREQYGDEQVKIYKSSFTAMYTAVTSHRQPCRMKLVCIGPEE
    KIVGIHGIGFGMDEMLQGFAVALKMGATKKDFDNTVAIHPTAAEEFVTMR

    >gi|283787896|ref|YP_003367761.1| lead, cadmium, zinc and mercury-transporting ATPase [Citrobacter rodentium ICC168]
    MSTPDTDGKKAPQFSSFRLAPAPQKADECCCDGACAAPETVPETVKGARYSWQVAGMDCAACARKVENAVRQIRGVNQVQ
    VLFATGKLVVDSDGDLRQQIERAVQNAGYRLQDEQAKAAAPESRLKENLPLLTLMVMMAIGWGLEQFNHPLGQLAFIATT
    LVGLYPIARQALRLMKSGSWFAIETLMSVAAIGALFIGATAEAAMVLLLFLIGERLEGWAASRARKGVSALMALKPEVAT
    RLRDGVREEVDVSALRPGDVIEVAAGGRLPADGKLISAFASFDESALTGESIPVERASGEKVPAGATSVDRLVTLEVLSE
    PGASAIDRILTLIEEAEERRAPIERFIDRFSRIYTPAIMAVALLVTLVPPLLFAASWQEWIYKGLTLLLIGCPCALVIST
    PAAITSGLAAAARRGALIKGGAALEQLGRITQIAFDKTGTLTVGKPRVTAIHPANGVSEADLLALAAAVEQGSTHPLAQA
    IVREAQSQGLTIPAAEAQRALVGSGIEARVNGDRVLICAAGKLPADAFARQIAQLESAGQTVVLAWRNDTVLGIIALQDT
    LRDDARTAISELKALGVNGVILTGDNPRAAAAIAGELGLDFNAGLLPEDKVRTVSALNQQSPLAMVGDGINDAPAMKAAA
    IGIAMGSGTDVALETADAALTHNRLTGLAQMIKLARATHANIRQNIAIALGLKGIFLVTTLLGITGLWLAVLADTGATVL
    VTANALRLLRRR

    >gi|283787941|ref|YP_003367806.1| thiosulfate sulfurtransferase [Citrobacter rodentium ICC168]
    MDQFECINVEEAHQKLQQGAAVLVDIRDPQSFAMGHAPQAFHLTNDTLGAFMREYDFDTAVMVMCYHGNSSKGAAQYLLQ
    QGYDAVYSVDGGFDAWHRHFPAEVASGA

    >gi|283788016|ref|YP_003367881.1| tRNA 2-thiouridine synthesizin protein D (sulfurtransferase) [Citrobacter rodentium ICC168]
    MRFAIMVTGPAYGTQQASSALQFARAVIEEGHTLSSVFFYREGVYNANQLTSPASDEVDLVRAWQQLNCQHGVALNICVA
    AALRRGVVDETEAGRLGLASANLQPGFTLSGLGALAEASLTCDRVVQF

    >gi|283788449|ref|YP_003368314.1| thiol:disulfide interchange protein [Citrobacter rodentium ICC168]
    MKKGLMIFTLLATAFSGLAHADDAAIRQSLTKLGVQSTDIQPAPVAGMKTVMTNSGVLYVTEDGKHIIQGPMYDVSGASP
    VNVTNQLLMKNLNALEKEMIVYKAPQEKHVITVFTDIT
    CGYCHKLHEEMKDYNALGITVRYLAFPRQGLESQAEKDMKSI
    WCAKDKNKAFDDAMAGKGVQAATCDIDIANHYALGVQFGVSGTPAMVLSNGYVVPGYQGPKELKAFLDAHQKQTSGK