Citrobacter koseri ATCC BAA 895 uid58143

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|157144414|ref|YP_001451733.1| hypothetical protein CKO_00123 [Citrobacter koseri ATCC BAA-895]
    MKAKPTHQAYSCGVIMSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNP
    GTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA

    >gi|157144485|ref|YP_001451804.1| thioredoxin 2 [Citrobacter koseri ATCC BAA-895]
    MNTVCTSCQAINRIPDDRIQDAAKCGRCGHDLFDGEVINATGETLDKLLKDDLPVVVDFWAPWCGPCRNFAPIFEDIAEE
    RSGKVRFVKVNTEAERELSARFGIRSIPTIMIFKNGEVIDMLNGAVPKAPFDSWLNESL

    >gi|157144542|ref|YP_001451861.1| 3-mercaptopyruvate sulfurtransferase [Citrobacter koseri ATCC BAA-895]
    METPMSTSWFVAADWLAEHIDDPQIQIIDARMAPPGQEDRDVAGEYRSGHIPGALFFDIEALSDHTSPLPHMMPRPEAFA
    VAMRELGVHQDRHLVVYDEGNLFSAPRAWWMLRTFGVENVSILAGGLAGWQRDELPLQEGEVELPEGEFDVKFTAEKVVR
    LTDVLLASHERTAQIVDARPAPRFNAEADEPRPGLKRGHIPGALNVPWTELVREGELKTTDELDVIFFSHGVSFDRPIIA
    S
    CGSGVTAAVVVLALATLDVPNVALYDGAWSEWGARNDLPVEPA

    >gi|157144581|ref|YP_001451900.1| hypothetical protein CKO_00301 [Citrobacter koseri ATCC BAA-895]
    MSDAVKIYHNPRCSKSRDTLSLLKSNGVEPEVVLYLETPADAATLRELLRMLGMSSARELMRQKEDLYKSLNLADSHLSE
    EALIQAMVENPKLMERPIVVANGQARIGRPPEQVLEIVS

    >gi|157144587|ref|YP_001451906.1| thioredoxin-dependent thiol peroxidase [Citrobacter koseri ATCC BAA-895]
    MNPLKAGDIAPKFSLPDQDGEQVNLTDFQGQRVLVYFYPKAMTPGCTVQACGLRDNMDDLKKAGVDVLGISTDKPEKLSR
    FAEKELLNFTLLSDEDHQVCEQFGVWGEKSFMGKTYDGIHRISFLIDADGKIEHVFDDFKTSNHHDVVLNWLKENA

    >gi|157144597|ref|YP_001451916.1| hypothetical protein CKO_00317 [Citrobacter koseri ATCC BAA-895]
    MITVYGIKNCDTIKKARRWLEAHGIDYRFHDYRADGIDAALLNTFIAESGWQPLLNTRGTTWRKLDEATRNGITDAASAA
    ALMTEMPAIIKRPLLCATGKPMLLGFSESSYQQFFDEV

    >gi|157144833|ref|YP_001452152.1| hypothetical protein CKO_00561 [Citrobacter koseri ATCC BAA-895]
    MKESMMKNLSRINDDARWQSVLDRDPDADGQFVFAVQTTGIFCRPSCRAKHALRQNVRFFASAEQALAAGFRPCKRCQPD
    KDNARQHQLDKITHACRLLEQDAPITLDALAQQVAMSPFHLHRLFKATTGMTPKAWQQSWRARRLRDALTKGETVTQAIL
    NAGFPDSGSYYRKADETLGMTAKQFRKGGDNLPVRYALADCALGRCLVAESERGICAILLGDDDAGLIASLHELFPAAQD
    EPADRPFQQRVRQVIASINARDMPLSLPLDIQGTAFQQQVWQALRTIPCGETVSYQQIASAIGKPKAVRAVASACGANKL
    AIVIP
    CHRVVRGDGALSGYRWGVARKAQLLQREARHEDK

    >gi|157144854|ref|YP_001452173.1| hypothetical protein CKO_00582 [Citrobacter koseri ATCC BAA-895]
    MKRNVLLIPFVIFLVIAAALLWQLARNAEGDDPTNLESALIGKPVPTFRLESLENPGQHYQADVLTQGKPVLLNVWATWC
    PTCRAEHQYLNQLSAQGIRVVGLNYKDDRQKAITWLKELGNPYALSLFDGDGMLGLDLGVYGAPETFLIDGKGIIRYRHA
    GDLNARVWESEIKPLWEQYSKEAAQ

    >gi|157145186|ref|YP_001452506.1| hypothetical protein CKO_00919 [Citrobacter koseri ATCC BAA-895]
    MKKLFISLLAVLSASVASAADFPVTIESCGTPVTFAGPPKRAVINDLNMSEMAFALHLQDRIVGLTGISGWYKMTPEFKK
    AMGSIPELAPKYPTLETLLAAEPDFFFAGWNYGMKVGGEVTPDTLSKYGIKTFVLSES
    CVFTTAHKNKATMDLLYNDVLT
    LGKIFGKRNDAQSLVSGWKKRLNELPKPAAGTRPLKVFVYDSGEDKPFTSGKYAMPTAIIEAAGGKNVMEAVDTSWGTTS
    WESVAATEPDFIILLDYQTGSGADALRHFLENHPLMKLTPAVQHHRYLKLQYAELTPGPANVDAVEKLARAMYPSTAK

    >gi|157145195|ref|YP_001452514.1| hypothetical protein CKO_00928 [Citrobacter koseri ATCC BAA-895]
    MNQPREVVIVGAGPAGVGMAALLRRSAIQDILVVDSHEVGASFMRWPEETRFITPSFFSNPFGQPDLNSVTPDSSLALFC
    GEEHPGGKTYASYLKAVLDEYQIPVMAPARIAKVALLSSGNFILITEAGEKLETRSLIWATGEFQFPDRQIFPGADI
    CCH
    YGDVTSWKDFRKGEYIVIGGYESAVDAAVNLLENGSSVKMLTRSAPWSTNHISDPSLSLSPYTRERLNRVMNHRLFEIYE
    DADVCEVIRMPGPGSSYKVHTTNGRAWATDEVPVLATGFQCGGGARQLAAFFEWNDDGYPVLTDEDCSTLFPGLYLVGPH
    VRHAGNIYCFIYKFRQRFPVVAESITRHLGLSSEGVRDWWVLPSEPDCCADEDCAC

    >gi|157145272|ref|YP_001452591.1| putative inner membrane protein [Citrobacter koseri ATCC BAA-895]
    MSWQQFKQAWLVKFWAPVPAVIAAGILSTYYFGITGTFWAVTGEFTRWGGQILQLFGVHAEEWGYYKLIHLEGSPLTRID
    GMMILGMFGGCFAAALWANNVKLRMPRSRIRIMQAIIGGMIAGFGARMAMG
    CNLAAFFTGIPQFSLHAWFFALATAIGSW
    FGARFTLLPIFRIPVKMQKVSAASPLTQKPDQARRRFRLGMLVFIGMIGWALLTAMNQPKLGLAMLFGVGFGLLIERAQI
    CFTSAFRDLWITGRTHMAKAIIFGMAVSAIGIFSYVQLGVEAKIMWAGPNAVIGGLLFGFGIVLAGGCETGWMYRAVEGQ
    VHYWWVGLGNVIGSTILAYYWDDFAPALATRWDKVNLLDTFGPLGGLLVTYLLLFAALMLIIGWEKRFFRRSGLTPAKES
    A

    >gi|157145444|ref|YP_001452763.1| disulfide bond formation protein B [Citrobacter koseri ATCC BAA-895]
    MALTAFALEMVALWFQHVMLLKPCVLCIYERSALFGVMGAGLVGAVAPKTPLRYVAIAIWIYSAWRGLQLAYEHTMIQLH
    PSPFMT
    CDFAARFPTWLPLDKWLPQVFLASGDCAERQWSFLTLEMPQWLLGIFAAYLAIAILVLIAQPFKPKRRDLFSR

    >gi|157145545|ref|YP_001452864.1| hypothetical protein CKO_01288 [Citrobacter koseri ATCC BAA-895]
    MQKIVIVANGAAYGSEALFNSLRLAIALREQAGDLDLRLFLMSDAVTAGLRGQKPAEGYNIQQMLEILTAQDVPVKLCKT
    CTDGRGITTLPLIDGVEVGTLVELAQWTLAADKVLTF

    >gi|157145652|ref|YP_001452970.1| thiol peroxidase [Citrobacter koseri ATCC BAA-895]
    MSQTVHFQGNPVAVANTIPQAGSKAQAFTLVAKDLSDVTLAQFAGKRKVLNIFPSIDTGVCAASVRKFNQLATEIDNTVV
    LCVSADLPFAQSRFCGAEGLSNVITLSTLRNPDFLKDYGVEITEGPLKGLAARAVVVIDENDNVIFSQLVNEITNEPDYA
    AALDVLKA

    >gi|157145663|ref|YP_001452982.1| O-6-alkylguanine-DNA:cysteine-protein methyltransferase [Citrobacter koseri ATCC BAA-895]
    MLRLLEDNIATPLGPLWVICDEQFRLRAVEWEQHSDRMEQLLDIHYRSEGYERIAAKNPGGLSDKLTAYFEGNLSIIDTL
    ETATGGTPFQREVWQALRTIPCGQVMHYGQLAEKLGRPGAARAVGAANGSNPVSIVVP
    CHRVIGRNGTMTGYAGGVQRKE
    WLLRHEGYLLL

    >gi|157145768|ref|YP_001453087.1| hypothetical protein CKO_01519 [Citrobacter koseri ATCC BAA-895]
    MTIHKKGQAHWEGDIKGGKGTVSTESGVLNQQPYGFNTRFEGVKGTNPEELIGAAHAACFSMALSLMLGEAGFTPSSIDT
    TADVSLDKVDAGFAITKIALHSEVAVPGIDASTFDGIIQKAKAG
    CPVSQVLKAEITLDYQLTS

    >gi|157145888|ref|YP_001453207.1| Na(+)-translocating NADH-quinone reductase subunit E [Citrobacter koseri ATCC BAA-895]
    MTDYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAMGMGLATTFVMTLASICAWLIDTWILIPLDLIYLRTLAFILV
    IAVVVQFTEMVVRKTSPALYRLLGIFLPLITTN
    CAVLGVALLNINLGHNFLQSALYGFSAAVGFSLVMVLFAAIRERLAV
    ADVPAPFRGNAIALITAGLMSLAFMGFSGLVKL

    >gi|157145893|ref|YP_001453212.1| electron transport complex RsxE subunit [Citrobacter koseri ATCC BAA-895]
    MSEIKDVIVQGLWKNNSALVQLLGMCPLLAVTSTATNALGLGLATTLVLTLTNLTISALRRWTPAEIRIPIYVMIIASVV
    SAVQMLINAYAFGLYQSLGIFIPLIVTN
    CIVVGRAEAFAAKKGPALSALDGFSIGMGATGAMFVLGSMREIIGNGTLFDG
    ADGLLGDWAKVLRVEIFHTDSPFLLAMLPPGAFIGLGLMLAVKYLIDEKMKKRRAEAVAAELPSGETGNV

    >gi|157145896|ref|YP_001453215.1| glutathionine S-transferase [Citrobacter koseri ATCC BAA-895]
    MPHYHTLNLSKKELPMKLFYKPGACSLASHITLRESGIDFTLDGVDLAKKRLENGDDYFAVNPKGQVPALLLDDGTLLTE
    GVAIMQYLADSVPDRQLLAPTGTISRYKTLEWLNYIATELHKGFTPLFRPDTPEEYKPIVRTQLEKKLHYVNDALQEGQC
    LCGQRFTIADAYLFTVLRWAKAVKLNMEGLSHIDVYMARVAERPCVAAALKAEGLN

    >gi|157145914|ref|YP_001453233.1| hypothetical protein CKO_01665 [Citrobacter koseri ATCC BAA-895]
    MSTTIEKIQRQIAENPILLYMKGSPKLPSCGFSAQAVQALSACGERFAYVDILQNPDIRAELPKYANWPTFPQLWVDGEL
    VGGCDILIEMYQRGELQQLINETAAKYKTEEPDAE

    >gi|157145964|ref|YP_001453283.1| iron-sulfur cluster assembly scaffold protein [Citrobacter koseri ATCC BAA-895]
    MELHSGTFNPDDFAWRGLTLTPEAAAHIRDLVAKQPGMLGVRLGVKQTGCAGFGYVLDTVSEPEKDDLLFETEGARLYVP
    LQAMPFIDGTEVDYVREGLNQLFKFHNPKAQNECGCGESFGV

    >gi|157145977|ref|YP_001453296.1| hypothetical protein CKO_01731 [Citrobacter koseri ATCC BAA-895]
    MENGAGVWGGESLLPGMSPLAQVYSGHQFGVWAGQLGDGRGILLGEQLLADGSTLDWHLKGAGLTPYSRMGDGRAVLRST
    IRESLASEAMHYLGIPTTRALSIVTSDTPVYRETVESGAMLMRLAQSHMRFGHFEHFYYRREPDKVRQLADFAIRHYWPQ
    FQAEEDKYALWFRDVVARTARLIADWQTVGFAHGVMNTDNMSVLGLTIDYGPFGFLDDYQPGFICNHSDHQGRYSFDNQP
    AVGLWNLQRLAQTLSPFMPVDTLNDALDGYQLALLTHYGQRMRQKLGFFTEQKEDNALLNELFALMAREGSDYSRTFRML
    SQTEQQSAASPLRDEFIDRAAFDGWFSRYRARLQQEQMDDATRQQHMQRVNPAVVLRNWLAQRAIASAEQGDMGELHQLH
    QVLRDPFTDRNDDYVSRPPDWGKRLEVS
    CSS

    >gi|157145982|ref|YP_001453301.1| putative glutathione peroxidase [Citrobacter koseri ATCC BAA-895]
    MGDAMQDTILNTEVTTIDGDVTTLEKYAGNVLLVVNVASKCGLTPQYEQLENIQKAWADQGFTVLGFPCNQFLGQEPGTE
    EEIKTYCSTTWGVTFPMFSKVDVNGENRHPLYQKLIAAAPAAVAPEGSGFYERMASKGRAPLYPDDILWNFEKFLIGRDG
    QVVQRFSPDMTPEDPGMVESIKIALAK

    >gi|157146029|ref|YP_001453348.1| hypothetical protein CKO_01783 [Citrobacter koseri ATCC BAA-895]
    MTALALASGLACASSWAADMAQSLTFSQLQQKQGAAIDTRQSAFYNGWPQTLNGPSGHEPSALNLSASWLDKMSDEQLAA
    WLQRHQLRKDAPLALYGNDNGVQAVKSRLQKAGFSQIATLSDALTDPSRLQKLPHFEQLAYPQWLHALQQNQPVTAKPAG
    DWKVIEAGWGAPKYYLLSHIPGAGYIDTNEVESEPLWNKVSDAQLKAMLAKHGIRHDTTVILYGRDVYAAARVAQIMLYA
    GVKDVRLLDGGWQTWSDAGLPVERGMPADVKPEPDFGVAIPAQPQLMLDMEQARALLHRQDASLVSIRSWPEFIGTTSGY
    SYIKPKGEIAGARWGHAGSDSTHMEDFHNPDGTMRSAEDIAAMWKQWDILPDQHVAFY
    CGTGWRASETFMYARAMGWKNV
    AVYDGGWYEWSSDPKNPVSTGERDPDSSK

    >gi|157146031|ref|YP_001453350.1| hypothetical protein CKO_01785 [Citrobacter koseri ATCC BAA-895]
    MPFLFWLVALFVGFLERKRARLTPVMRALLMTRVSQVCHCAFCVDANSLRLAERCGALDKVQAVAGWQSSTLFSEEERVA
    LAYAEAVTATPPQVDEALKAMMKRYFTDDAITEMTALIAFQNLSARFNAALDIPSQGLCDALKGAPHV

    >gi|157146037|ref|YP_001453356.1| selenophosphate synthetase [Citrobacter koseri ATCC BAA-895]
    MSMSEHAIRLTQYSHGAGCGCKISPKVLETILHSEQAKFVDPNLLVGNETRDDAAVYDLGNGTSIISTTDFFMPIVDNPF
    DFGRIAATNAISDIFAMGGKPIMAIAILGWPINKLSPEIAREVTEGGRFACRQAGIALAGGHSIDAPEPIFGLAVTGVVP
    TERVKKNSTAQAGCKLFLTKPLGIGVLTTAEKKSLLKPEHQGLATEVMCRMNIAGASFAHIDGVKAMTDVTGFGLLGHLS
    EMCQGAGVQARICYQDIPKLPGVEEYIKLGAVPGGTERNFASYGHLMGDMPREVRDLLCDPQTSGGLLLAVTPEAVEEVK
    VTAAEFGIELTAIGELVDARGGRAMVEIR

    >gi|157146045|ref|YP_001453364.1| methionine sulfoxide reductase B [Citrobacter koseri ATCC BAA-895]
    MSMAKARCEQMANQPSAEDLKKKLSEMQFYVTQNHGTEPPFTGRLLHNKRDGVYHCLVCDAPLFHSQTKYDSGCGWPSFY
    EPVSEESIRYIKDFSHGIQRIEIRCGNCDAHLGHVFSDGPQPTGERY
    CVNSASLSFTDDENGEQTKG

    >gi|157146254|ref|YP_001453573.1| hypothetical protein CKO_02011 [Citrobacter koseri ATCC BAA-895]
    MPVLHNRISNDALKARMLAETEPRTTISFYKYFTIVDPQSTRDALYQMFTSLNVFGRVYLAREGINAQISVPQSQVAAFR
    EQLYAFDPALNGLRLNIALDDDGKSFWVLRMKVRERIVADGIDDPNFDASDVGEYLKAAEVNAMLDDPDAVFIDMRNHYE
    YEVGHFENALEIPADTFREQLPKAVEMMQEHRDKKIVMY
    CTGGIRCEKASAWMKHNGFNKVWHIEGGIIEYARKAREQGL
    PVRFIGKNFVFDERMGERISDEVIAHCHQCGAPCDSHTNCKNDGCHLLFIQCPACAEKFKGCCSELCCEESSLPEEEQRR
    RRAGRENGNKIFNKSRGRLNTQLGIPDPAE

    >gi|157146293|ref|YP_001453612.1| hypothetical protein CKO_02051 [Citrobacter koseri ATCC BAA-895]
    MRWHNVLLLAAAILISGCKEEKLAVGAPAPALAAFDLQGQESGLERWQGKAVYLNFWSAGCGGCLAEMDTLEALSKKWGD
    KVVVVAVNTDPETVRINDLLAKHQITYPVVRDQLNITQERYQVIGTPTSVLIDPEGRVLELHQGMRKPPELEATFARLAA
    R

    >gi|157146302|ref|YP_001453621.1| hypothetical protein CKO_02060 [Citrobacter koseri ATCC BAA-895]
    MLSKLRRWLREGAILLVLLAGVIILLDVWRSPQMPAMFDSTPLHTLDGETVTLASISEERPVLLYFWASWCGICRFTTPD
    VARLQSEGENVMTIALRSGNDGEVSRWLSRKGVTFPVVNDSGGEISRNWEISVTPTLVVVSKGQVVTTTSGWTSYWGMKL
    RLWRAAMF

    >gi|157146303|ref|YP_001453622.1| hypothetical protein CKO_02061 [Citrobacter koseri ATCC BAA-895]
    MKYLMIMLLALFTGLSVAKEPAPFTPEQEKQIEALIQEALFNDPASPRIGAEKATLTLVNFTDYNCPYCKQLDPLLEKIV
    QKYPQVAVVIKPLPFKGESSVLSARTALTTWREHPQQFLALHEKLMQKKGYHTTASIKQAQEKSAATPVTLDEKSMETLS
    TNLQLARLVGVQGTPATIIGDEMIPGAVSWETLEAVVKEKLAVAHAQ

    >gi|157146304|ref|YP_001453623.1| hypothetical protein CKO_02062 [Citrobacter koseri ATCC BAA-895]
    MITVFRQTLCCLLLLWLPVSWAAESGWLRSPDNDHASVRLRADTSPEGETRLLLDVKLENGWKTYWRSPGEGGVAPAVAW
    KENMPAVDWFWPTPSRFDVAGMTTQGYHHRVTFPMTVRGPSPAMLSGVLTLSTCSNVCLLTDYPFTLKPSAHDPAFAHDY
    AQAMGQIPLSRGLTQTLSVGARPGALVVEATRAGGWSSPALFLDAVDNADFGKPQLRVEGEKLLATVPVSDGWGEGAPDL
    RGQTVTLVLANDGVAQESTLAIGSTTAKMADSAELPLWQVMLMALAGGLILNLMPCVLPVLGMKLGSILLVEEKSRQRIR
    RQFLASVAGIIASFMALAMLMTVLRLTHQALGWGIQFQSPWFIGFMVLVMLIFSASLFGLFEFRLPSAMTTRLATHGGNG
    MAGHFWQGAFATLLATPCSAPFLGTAVAVALTASFPVLWGLFLALGVGMSLPWLFVALRPGLALRLPRPGRWMNGLRRVL
    GVMMLGSAIWLATLLLPHLGYATSSPAKERVVWQPLSEQAIQDALAQHKRVFIDVTAEW
    CITCKVNKYNVLQREEIQDAL
    QQPDVVALRGDWTLPADDITDFLKKRGQVAVPFNQIYGPGLPQGQSLPTLLTRDAVLQTLRDAKGVTP

    >gi|157146425|ref|YP_001453744.1| thioredoxin reductase [Citrobacter koseri ATCC BAA-895]
    MGTTKHSKLLILGSGPAGYTAAVYAARANLQPVLITGMEKGGQLTTTTEVENWPGDPNDLTGPLLMERMHEHATKFDTEI
    IFDHINSVDLQNRPFRLTGDSGEYTCDALIIATGASARYLGLPSEEAFKGRGVSA
    CATCDGFFYRNQKVAVIGGGNTAVE
    EALYLANIAAEVHLIHRRDGFRAEKILIKRLMDKVENGNIVLHTHRTLEEVTGDQMGVTGLRLRDTQNPDNIESLDVAGL
    FVAIGHSPNTAIFEGQLELENGYIKVQSGIHGNATQTSVPGVFAAGDVMDHIYRQAITSAGTGCMAALDAERYLDGLADA
    CK

    >gi|157146498|ref|YP_001453817.1| glutaredoxin 1 [Citrobacter koseri ATCC BAA-895]
    MSSRKKTMFTVIFGRPGCPYCVRAKELAEKLSTERDDFNYRYIDIHAEGITKADLEKTVGKPVETVPQIFVDQKHIGGYT
    DFEAWAKENLNLFA

    >gi|157146522|ref|YP_001453841.1| molybdopterin biosynthesis protein MoeB [Citrobacter koseri ATCC BAA-895]
    MAELSDQEMMRYNRQIILRGFDFEGQEALKDARVLVVGLGGLGCAATQYLAGAGVGQLTLLDFDTVSVSNLQRQTLHSDA
    TVGQPKVDSAREALARINPYITLTPINALLDEPALNALIAGHDLVLDCTDNVAIRNQLNAGCFAAKVPLVSGAAIRMEGQ
    ITVFTWQEGEPCYRCLSRLFGENALT
    CVEAGVMAPLIGVIGSLQAMEAIKLLAHYGQPASGKIVMYDAMTCQFREMKLMR
    NPGCEVCGAQVPDGG

    >gi|157146778|ref|YP_001454096.1| hypothetical protein CKO_02552 [Citrobacter koseri ATCC BAA-895]
    MLDTNMKTQLKAYLEKLTRPVELIATLDDSAKSAEIKELLAEIAELSEKVTFKEDNSLPVRKPSFLIANPGSDQGPRFAG
    SPLGHEFTSLVLALLWTGGHPSKEAQSLLEQIRDIDGDFEFETYYSLS
    CHNCPDVVQALNLMAVLNPRIKHTAIDGGTFQ
    NEITDRNVMGVPAVYLNGNEFGQGRMTLTEIVAKVDTGAEKRAAEELNKRDAYDVLIVGSGPAGAAAAVYSARKGIRTGL
    MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVDDYDVDVIDSQSASKLLPAATEGGLHQIETASGAVLKARSIII
    ATGAKWRNMNVPGEDQYRTKGVTY
    CPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKV
    RSLKNVDIILNAQTTEVKGDGSKVTGLEYRDRVSGDIHNVALSGIFVQIGLLPNTNWLEGAIERNRMGEIIIDGRCETSV
    KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRSKTA

    >gi|157146780|ref|YP_001454098.1| alkyl hydroperoxide reductase subunit C [Citrobacter koseri ATCC BAA-895]
    MSLINTKIKPFKNQAFKNGEFIEVTEKDTEGRWSVFFFYPADFTFVCPTELGDVADHYDELQKLGVDVYSVSTDTHFTHK
    AWHSSSETIAKIKYAMIGDPTGALTRNFDNMREDEGLADRATFVVDPQGIIQAIEVTAEGIGRDASDLLRKIKAAQYVAA
    HPGEVCPAKWKEGEATLAPSLDLVGKI

    >gi|157146781|ref|YP_001454100.1| disulfide isomerase/thiol-disulfide oxidase [Citrobacter koseri ATCC BAA-895]
    MIKRTLLLTLFPLIAFAEELPAPVKAIEKQGITILKSFDAPGGMKGYLGKYQDMGVTIYLTPDGKHAISGYMYDEKGANL
    SNALIEKEIYAPVGREMWQRMEKASWILDGKKEAPVILYVFADPF
    CPYCKQFWQQARPWVESGKVQLRTLLVGVIKPESP
    ATAAAILSTRDPAKTWHDYEASGGKLNLAIPSPLPEDKMKMLNIHQKLMDDLGANATPAIYYMNKENMLQQVVGLPEKAQ
    LDIMMGEH

    >gi|157146873|ref|YP_001454192.1| hypothetical protein CKO_02648 [Citrobacter koseri ATCC BAA-895]
    MSVQNIVNINESNLQQTLEQSMTTPVLFYFWSERSQHCLQLTPVLESLAAQYNGQFILAKLDCDAEQMIASQFGLRAIPT
    VYLFQNGQPVDGFQGPQPEEAIRALLDKVLPREEELKAQQAMQLMQEGNYIEALPLLKDAWQLSHQNSELGLLLAETQIA
    LNRTEDAEAVLKTIPLQDQDTRYQGLVAQIDLLKQAADTPEIQQLQQQVADNPEDAALAAQLALQLHQVGRNEEALELLF
    SHLKKDLAAADGQARKTFQEILAALGTGDALASKFRRQLYALLY

    >gi|157146890|ref|YP_001454209.1| copper exporting ATPase [Citrobacter koseri ATCC BAA-895]
    MSQTIDLTLDGLSCGHCVKRVKESLEQRPDVEQADVTVTEAHVTGSASAEALIETIKQAGYGAELSHPKAKPLAESSIPS
    EALTAVPPELPAVTADDESQQLLLSGMS
    CASCVSRVQNALQSVPGVTQARVNLAERTALVMGSASAADLVQAVEKAGYGA
    EAIEDDVKRRERQQETALATMKRFRWQAIVALLVGVPVMVWGMLGDNMMVTADNRSLWLAIGLATLAVMVFAGGHFYRSA
    WKSLMNGTATMDTLVALGTGVAWLYSMSVNLWPQWFPMEARHLYYEASAMIIGLINLGHMLEARARQRSSKALEKLLDLT
    PPTARVVTDDGEKSVPLADVQPGMLLRLTTGDRVPVDGEITQGEAWLDEAMLTGEPIPQQKGEGDSVHAGTVVQDGSVLF
    RASAVGSHTTLSRIIRMVRQAQSSKPEIGQLADKISSVFVPVVVVIALVSAGIWYIFGPAPQIVYTLVIATTVLIIACPC
    ALGLATPMSIISGVGRAAEFGVLVRDADALQRASTLDTVIFDKTGTLTEGKPQVVAIRTFGDTDEASALRLAAALEQGSS
    HPLAHAILEKAADATLPQVNNFRTLRGLGVSGEADGHTLLLGNQALLNEQQVVTTAMDAEISAQASQGATPVLLAIDGKA
    AALLAIRDPLRSDSVAALQRLHRAGYRLVMLTGDNPTTANAIAKEAGIDEVIAGVLPDGKADAIKRLQSQGRQVAMVGDG
    INDAPALAQADVGIAMGGGSDVAIETAAITLMRHSLMGVADALAISRATLRNMKQNLLGAFIYNSIGIPVAAGILWPFTG
    TLLNPVVAGAAMALSSITVVSNANRLLRFKPKE

    >gi|157146981|ref|YP_001454300.1| hypothetical protein CKO_02758 [Citrobacter koseri ATCC BAA-895]
    MVLVTRQAPDFTAAAVLGSGEIVENFNFKQHTNGKATVLFFWPMDFTFVCPSELIAFDKRYEEFQARGVEVVGVSFDSEF
    VHNAWRNTPVDKGGIGAVKYAMVADVKREIQKAYGIEHPEAGVALRGSFLIDANGVVRHQVVNDLPLGRNIDEMLRMVDA
    LQFHEEHGEVCPAQWEKGKEGMNASPDGVAKYLTENVASL

    >gi|157147211|ref|YP_001454530.1| hypothetical protein CKO_02994 [Citrobacter koseri ATCC BAA-895]
    MNDRDFMRYSRQILLGDIAIEGQQKLLASRVLIVGLGGLGSPAALYLAGAGIGTLVLADDDEVHLSNLQRQILFTTDDIA
    RPKSQVTKQRLARLNPDIELLALQQRLTGDALRHAVERADVVLDCTDNMATRQEINAACVALDTPLITASAVGFGGQLMV
    LTPPWEQGCYRCLWPDDEEPERN
    CRTAGIVGPVVGVMGTLQALEAIKLLSGMDIPGGELRLFDAKTSQWRSLALHRASGC
    PVCGGRHADSVQ

    >gi|157147240|ref|YP_001454559.1| soluble pyridine nucleotide transhydrogenase [Citrobacter koseri ATCC BAA-895]
    MPHSWDYDAIVIGSGPGGEGAAMGLVKQGARVAVIERYHNVGGGCTHWGTIPSKALRHAVSRIIEFNQNPLYSDHSRLLR
    SSFADILNHADNVINQQTRMRQGFYERNHCEILQGNAHFVDENTLALECHDGTVETLTAEKFVIACGSRPYHPADVDFAH
    PRIYDSDSILSLHHEPRHVIIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAFLDQEMSDSLSYHFWNSGVVIRHNEEY
    EKIEGCDDGVIMHLKSGKKLKADCLLYANGRTGNTDSLALGNIGLETDSRGQLKVNSMYQTALPHIYAVGDVIGYPSLAS
    AAYDQGRIAAQALVKGEATAHLIEDIPTGIYTIPEISSVGKTEQQLTAMKVPYEVGRAQFKHLARAQIVGMNVGTLKILF
    HRETKEILGIHCFGERAAEIIHIGQAIMEQKGGGNTIEYFVNTTFNYPTMAEAYRVAALNGLNRLF

    >gi|157147360|ref|YP_001454679.1| periplasmic protein disulfide isomerase I [Citrobacter koseri ATCC BAA-895]
    MKKIWLALAGMILAFSASAAQFSDGKQYITLDKPVAGEPQVLEFFSFYCPHCYQFEEVLHVSDNVKKKLPEGTKMTKYHV
    EFLGPLGKDLTQAWAVAMALGVEDKITAPMFEAVQKNQTVQSAADIRKVFVDAGVKGEDYDAAWNSFVVKSLVAQQEKAA
    ADLQLQGVPAMFVNGKYQVNPQGMDTSSMDIFVQQYADTVKHLVEKK

    >gi|157147412|ref|YP_001454731.1| hypothetical protein CKO_03211 [Citrobacter koseri ATCC BAA-895]
    MSDDVALPLQFTEAAAKKVKSLIADEDNPNLKLRVYITGGGCSGFQYGFTFDDQVNEGDMTIEKQGVGLVVDPMSLQYLV
    GGAVDYTEGLEGSRFVVTNPNAKSTCGCGSSFSI

    >gi|157147457|ref|YP_001454776.1| dihydrolipoamide dehydrogenase [Citrobacter koseri ATCC BAA-895]
    MMSTEIKTQVVVLGAGPAGYSAAFRCADLGLETVIVERYNTLGGVCLNVGCIPSKALLHVAKVIEEAKALAEHGIVFGEP
    KTDIDKIRTWKEKVITQLTGGLAGMAKGRKVKVVNGLGKFTGANTLEVEGENGKTVINFDNAIIAAGSRPIQLPFIPHED
    PRVWDSTDALELKSVPKRLLVMGGGIIGLEMGTVYHALGSEIDVVEMFDQVIPAADKDIVKVFTKRISKKFNLMLETKVT
    AVEAKEDGIYVSMEGKKAPAEAQRYDAVLVAIGRVPNGKNLDAGKAGVEVDDRGFIRVDKQLRTNVPHIFAIGDIVGQPM
    LAHKGVHEGHVAAEVIAGKKHYFDPKVIPSIAYTEPEVAWVGLTEKEAKEKGISYETATFPWAASGRAIASDCADGMTKL
    IFDKESHRVIGGAIVGTNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEVFEGSITDLPNPKAKKK

    >gi|157147807|ref|YP_001455126.1| hypothetical protein CKO_03611 [Citrobacter koseri ATCC BAA-895]
    MTNVPEGMEIALFAMGCFWGVERLFWQLPGVYSTAAGYTGGYTPNPTYREVCSGQTGHAEAVRVVYDPQVISYEQLLQVF
    WENHDPAQGMQQGNDHGTQYRSAIYPLTPEQNAAAHASLARFQSAMTAANDDRHITTEINTATPFYYAEDDHQQYLHKNP
    YGYCGIGGIGVCLPPQG

    >gi|157147894|ref|YP_001455213.1| thiol:disulfide interchange protein precursor [Citrobacter koseri ATCC BAA-895]
    MAQRILTLILLLCSTSAFAGLFDAPGRSQFVPADQAFSFDFQQNQHDLNLSWQVKDGYYLYRKQISITPSQAEIAEVRLP
    AGVWHEDEFYGKSEIYRKRLNIPLIVNQAASGATLTVTYQGCADAGFCYPPETKTVPLSEVSASTVAKSTPSPVAAQTEE
    TPQPAARLPFSALWALLIGIGIAFTPCVLPMYPLISGIVLGGKQRLSTGRALLLTFIYVQGMALTYTALGLVVAAAGLQF
    QAALQHPYVLIGLALVFTLLALSMFGLFTLQLPSSLQTRLTLMSNRQQGGSPGGVFVMGAIAGLICSPCTTAPLSAILLY
    IAQSGNMWLGGGTLYLYALGMGLPLILITVFGNRLLPKSGPWMEHVKTAFGFVILALPVFLLERVIGDEWGLRLWSLLGV
    AFFGWAFITSLHARRSGMRIVQIILLAAALVSVRPLQDWAFGATTAQTQAHLNFKPITTVDALNQALAEAKGKPIMLDLY
    ADW
    CVACKEFEKYTFSDPQVQQTLGDTVLLQANVTANNAQDVALLRHLNVLGLPTILFFDAQGHEHPNARVTGFMDATTF
    SAHLRDRQP

    >gi|157148045|ref|YP_001455364.1| hypothetical protein CKO_03852 [Citrobacter koseri ATCC BAA-895]
    MKTLFDVAVMGGGPGGYVAALRAAQRGLTVVCIDDGVNALGEPSPGGTCLNVGCIPSKSLLQSSELFVQIQHEAGIHGVK
    VADVSFDAAAMIQRKDAIVRRLTQGIRLLFDKNKVMHVSGLATLQGQQDDCWQLTVNEQTISAKNVVIATGSQPRQLAGV
    TVDNTHILDNGGALALTD
    CPVRLGVIGAGVIGLELGSVWNRVGAQVTLLEMAETFLPALEPRLAGDVRKALAASGLEMRF
    GVSIDAIERQNDEVVIRWRQGDNAQETRVDKLIVAIGREPRLSGVDLAALGLVPDTRGGIDVDALCRTGKPGLWAIGDVV
    RGPMLAHKAMEEGLVVADQIAGLPVEPVNFLLIPSVIYTQPEVAWIGENEVTLKAIGIPFTKGHSLFAGNGRALALGQDG
    GRCTLYADKRTDRVLGGAIVGPQASELINEIALAMAFSASGEDIACTVHAHPTLSEVIHEAAMALNKQALHG

    >gi|157148210|ref|YP_001455529.1| hypothetical protein CKO_04021 [Citrobacter koseri ATCC BAA-895]
    MMTTLRQPYYELSPEVYSALGQAKKALENSALDTTLMELIYLRISQINGCAFCLEMHSKALRKSGVAQSKLDALAGWRVS
    HHFSEQERAALAWAESVTDIARTHAEDDAYLPLLESFSAREISDLTFAISLMNCFNRLAVGMRM

    >gi|157148211|ref|YP_001455530.1| glutaredoxin-like protein [Citrobacter koseri ATCC BAA-895]
    MEIRIMRITIYTRNDCVQCHATKRAMESRGFDFEMVNVDLVPDAADTLREKGFRQLPVVIAGDTSWSGFRPDMINRLHPD
    ARVASA

    >gi|157148430|ref|YP_001455749.1| thiol:disulfide interchange protein DsbC [Citrobacter koseri ATCC BAA-895]
    MKKRFMMFTLLAAAFSGMVHADDAAIRQSLTKLGVQSTEIQPAPVAGMKTVLTNSGVLYVTDDGKHIIQGPMYDVSGASP
    VNVTNQLLMKHLNALEKEMIVYKAPQEKHVITIFTDIT
    CGYCHKLHEEMKDYNALGITVRYLAFPRQGLESQAEQDMKSI
    W
    CAKDRNKAFDEAMAGKGVKAATCDIDIANHYALGVQFGVSGTPAIVLSNGYVVPGYQGPKEMKAFLDAHQKQTSGK

    >gi|157148913|ref|YP_001456232.1| sulfur transfer complex subunit TusD [Citrobacter koseri ATCC BAA-895]
    MRFAIVVTGPAYGTQQASSALQFAHALVNEGHELSSVFFYREGVYNANQLTSPASDEFDLVRAWQQLGAQHGVALNICVA
    AALRRGIVDETEAKRLALASANLQPGFSLSGLGALAEASLTCDRVVQF

    >gi|157149006|ref|YP_001456324.1| thiosulfate sulfurtransferase [Citrobacter koseri ATCC BAA-895]
    MDQFECINVEEAHQKLHQGTAVLVDIRDPQSYAMGHTPQAFHLTNDTLGAFMRDHDFDTVVMVMCYHGNSSKGAAQYLLQ
    QGYDAVYSIDGGFDAWHRHFPSEVAFGA

    >gi|157149059|ref|YP_001456378.1| zinc/cadmium/mercury/lead-transporting ATPase [Citrobacter koseri ATCC BAA-895]
    MLTPDTDGKKVPQFSSFKLAPAPRKIDDCCCEGACATEALVPDTIEGTRYTWKVAGMDCAACARKVENAVRQVGGVNQVQ
    VLFATEKLVVDANADIRQHVERAVQKAGYTLRDEQATAEARESRLQENLPLITLIIMMAISWGLEQFNHPFGQLAFIATT
    LVGLYPIARQALRLMKTGSWFAIETLMSVAAIGALFIGATAEAAMVLLLFLIGERLEGWAASRARKGVSALMALKPETAT
    RLRDGVREEVAINTLQPGDIIEVAAGGRLPADGRLVSGFASFDESALTGESIPVERSTGEKVPAGATSVDRLVTLEVLSE
    PGASAIDRILKLIEEAEERRAPIERFIDRFSRIYTPVIMAVALLVTLVPPLLFAASWQEWIYKGLTLLLIGCPCALVIST
    PAAITSGLAAAARRGALIKGGAALEQLGRVTQVAFDKTGTLTVGKPRVTAIHPASGIGEAELLALAAAVEQGATHPLAQA
    IVREAQTRELTIPPALEQRALVGSGIEAQVNGERILICAAGKRPAEAFAGQISELESAGQTVVLVLRNDDVLGVLALQDT
    LRDDARTAIGELNQLGVKGVILTGDNPRAAAAIAGELGLTFKAGLLPEDKVRAVTALNQHAPLAMVGDGINDAPAMKAAA
    IGIAMGSGTDVALETADAALTHNRLRGLVQMIQLARATHANIRQNIAIALGLKGIFLITTLLGITGLWLAVLADTGATVL
    VTANALRLLRKG

    >gi|157149117|ref|YP_001456436.1| glutathione reductase [Citrobacter koseri ATCC BAA-895]
    MTKHYDYIAIGGGSGGIASINRAAMYGQKCALIEAKELGGTCVNVGCVPKKVMWHAAQIREAIHMYGPDYGFDTTINAFN
    WDTLIASRTAYIDRIHTSYDNVLGKNNVDVIKGFARFVDARTLEVNGETITADHILIATGGRPSHPSIPGTEYGIDSDGF
    FALPALPERVAVVGAGYIAVELAGVINGLGAQTHLFVRKHVPLRSFDPMITETLVEVMNTEGPTLHTHAIPKAVVKNADG
    SLTLQLEDGRSETVDCLIWAIGREPATDNVNLAATGVKTNEKGYIVVDKFQNTSVEGIYAVGDNTGAVELTPVAVAAGRR
    LSERLFNNKPNEHLDYSNIPTVVFSHPPIGTVGLTEPQAREQYGDDQVKVYKSSFTAMYTAVTSHRQPCRMKLVCVGEDE
    KIVGIHGIGFGMDEMLQGFAVALKMGATKKDFDNTVAIHPTAAEEFVTMR

    >gi|157149227|ref|YP_001456546.1| glutaredoxin 3 [Citrobacter koseri ATCC BAA-895]
    MANIEIYTKVTCPFCHRAKALLSSKGVSFQELPIDGDAVKREEMIKRSGRTTVPQIFIDAQHIGGCDDLYALDARGGLDP
    LLR

    >gi|157149228|ref|YP_001456547.1| hypothetical protein CKO_05068 [Citrobacter koseri ATCC BAA-895]
    MQEIMQFVGRHPILSIAWIALLVAVLFTTFKGLMSKVKVITRGEATRLINKEDAVVVDLRQRDDFRKGHIAGATNLLPSE
    IKANNVGELEKHKDKPLIVVDGSGMQ
    CQESANALIKAGFEKVFVLKEGVAGWSGENLPLVRGK

    >gi|157147563|ref|YP_001454882.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Citrobacter koseri ATCC BAA-895]
    MQILLANPRGFCAGVDRAISIVENALAIYGAPIYVRHEVVHNRYVVDSLRERGAIFIEQISEVPDGAILIFSAHGVSQAV
    RNEAKSRDLTVFDAT
    CPLVTKVHMEVARASRRGEESILIGHAGHPEVEGTMGQYSNPEGGMYLVESPDDVLSLDVKNEGK
    LSFMTQTTLSVDDTSDVIDALRQRFPKIVGPRKDDICYATTNRQEAVRALAEQADVVLVVGSKNSSNSNRLAELAQRMGK
    AAFLIDDATDIQEAWVKEAKCVGVTAGASAPDILVQNVIARLQELGGGEAIPLEGREENIVFEVPKELRVDVREVE