Chromobacterium violaceum ATCC 12472 uid58001

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|34495538|ref|NP_899753.1| hypothetical protein CV_0083 [Chromobacterium violaceum ATCC 12472]
    MIIDWSHFTPWSALAGGALIGLAAAWLILFNGRVAGISGIVGHLLSPGGDKGWRLAFVAGLALSPWLYRLFAAPPDVQLD
    DRWGLLIAAGLLVGYGSRLGSG
    CTSGHGVCGLARLSPRSLAATLAFMAAGFAAAWLTRHWIG

    >gi|34495540|ref|NP_899755.1| hypothetical protein CV_0085 [Chromobacterium violaceum ATCC 12472]
    MSNEVNYPELTHAISKHLATLRADVPEVMQGFNDMARAATRDGALDKKTKELIALALGVAARCDGCLGFHAQALVKLGAS
    KTEVEEALAMAVYMGGGPSLMYSAHALAAFEQFSAKTA

    >gi|34495664|ref|NP_899879.1| organic hydroperoxide resistance protein [Chromobacterium violaceum ATCC 12472]
    MNPLQKVLYTAEATATGGRDGRAESSDGALQVKLSTPRELGGLGGDGTNPEQLFAAGYSACFIGALKVAAQQAGVRLPAE
    VSVTGKVSIGPIAHGFGIAAKLAVSLPGLERDAGLRLIEAAHGI
    CPYSNATRGNIEVELTLA

    >gi|34495675|ref|NP_899890.1| methylated-DNA-[protein]-cysteine S-methyltransferase [Chromobacterium violaceum ATCC 12472]
    MEAMLSADAEAGRDYARVRDAIRYLVAHAGEQPQLAEVAAALCLSESRLQRLFSRWAGVSPKRFIQQLTCEAAKARLAAG
    APVLPLSHELGLSGGGRLHDLFVTLEAMTPGEYQQGGAGLDIAWSVESTRFGPVLLAQTARGVCALQFLSGDGEAEAWLR
    AQWPRAALRHVPGQGGALCRRLFDPLAEADGPPLALRVQGSNFQIQVWRALLTVPYGGLIGYGQLAEKIGRPGAARAVGN
    AVGANPVAWLIP
    CHRVIRAEGAVGGYRWGEERKLDLIGWESARLSREEATA

    >gi|34495688|ref|NP_899903.1| hypothetical protein CV_0233 [Chromobacterium violaceum ATCC 12472]
    MLREITAPALAAQLADPQAARPVLLDVREGWEYQLAHIEGSVHIPMNLIPIRMSELPDDAPIVAICHHGMRSAQVALFLQ
    NAGFDDVINLQGGIDAWSVQVDPAVARY

    >gi|34495744|ref|NP_899959.1| glutathione S-transferase family protein [Chromobacterium violaceum ATCC 12472]
    MKLYYSPGACSLASHIVLFASGLPFDAESVSLREVPHTTAGGVDFTTINPKGYVPALRLDNGELLTEGVAIMQYVADQAP
    DKQLAPANGTLPRYRLQEWLNFISTEIHKNFSPLFFGKNDEVKDDAWGRLQPRFVLLQAQLEKTPYLLGGQFSVADAYLF
    TCLSWAQYVQRSLADYPALLDYLKRVAALPAVQQALKAEGLLK

    >gi|34495846|ref|NP_900061.1| methylated-DNA-[protein]-cysteine S-methyltransferase [Chromobacterium violaceum ATCC 12472]
    MRVTDPRQIDTFYRALLERAADHVGIFYVGVKTTGVFCIATCRARKPKRENVVFYTDLKDALDAGYRPCKVCRPSENAHT
    APSDVAAAIAWLRQHPKARLSDDGLRLLGCRPERVRRWFQQHYGMSFHAFQRSVRINMALEELKGGRCATDAALDCGYDS
    LSGFGYTCKKLTGCAPTAAAQIIRIHRFTTPLGPMFVCASERGVCLMAFVDRKTLETEFHDLQRLLQARILAGENQHTRQ
    AERQVGEYFAGTRFQFNLALDMPGSEFQKSVWQALQTIPYGEIASYADQAESLGRPEAVRAVARAHGANRVAIVVP
    CHRV
    LGTDGSLTGYGGGLARKQWLLAHERRHALPRS

    >gi|34495983|ref|NP_900198.1| dihydrolipoamide dehydrogenase [Chromobacterium violaceum ATCC 12472]
    MSNLIELKVPDIGGHNNVDVIEVFVKPGDVIEKEASLITLETDKATMEVPAEAAGTVKEVRVTVGSKVSEGDLVVILEAA
    GAAAAAPAEVKPVETTGVASATTQAGFAPQAAPVAASHSGGADIECDVMVLGGGPGGYSAAFRAADLGLKVVIVERYATL
    GGV
    CLNVGCIPSKALLHNAAVIDEVSHLAANGIKFGKPEVDIDMLRGYKEKVIAKLTGGLGGMAKARKVEIVRGNGHFID
    PHHIEVSLTTGKGREESGEKKIVKFKNAIIAAGSRVVKLPFIPNDPRVVDSTGALELKGVADRMLIIGGGIIGLEMGTVY
    STLGARLDVVEMLDGLMQGADRDLVKVWQKWNAHRFDNIMLNTKTVAVEPKEDGVWVTFEGEQAPKEPQRYDLVLYATGR
    APNGKLIGAENAGIAVTDRGFIQVDKQQRTNVPHIFAIGDIVGQPMLAHKGVHEGHVAAENCAGMKSYFDARVIPGVAYT
    DPEVAWVGVTEDEAKKQGLKIEKGVFPWAASGRAIANGRDEGFTKLIFDAESHQIIGGGIVGPHAGDMIGEVCLAIEMGC
    DATDIGKTIHPHPTMGESIGMAAEVAHGTCTDLPPQRKK

    >gi|34496034|ref|NP_900249.1| hypothetical protein CV_0579 [Chromobacterium violaceum ATCC 12472]
    MRLDYTQLSPKAYQGLLACKNALAESGLGLPLIELAYLRVAQLNGCAFCLKLHSQALRRRGESQEKLDQLAGWDAADALS
    PREAAAIAWTEAVTRIGETRAPDSLYQPLREHFSDAEISDLTLAVALMNAFTRVAVAMRQ

    >gi|34496063|ref|NP_900278.1| hypothetical protein CV_0608 [Chromobacterium violaceum ATCC 12472]
    MSRFLKRLLGLFIVLVLSACAQKIDFKGTAIEDASMGGNFKLTDFHGQPRALDEFRGKVVALFFGYTSCPDVCPTTMLEY
    ASVMKQLGADGDKVQVLFVSVDPERDTPQVLAGYVPHFDKRFIGLTGGAADIEKVMKQYKVVAQKVKNEEGGYTVDHSAG
    SYLLDKEGKLRVYEAYGTPSANLASDIRQLLR

    >gi|34496225|ref|NP_900440.1| arsenate reductase (glutaredoxin) [Chromobacterium violaceum ATCC 12472]
    MIRLYHNPKCSKSRAALSLLEEAGAEIEIVEYLKHPPSYEELDQLLGLLGLEPRELMRQKEEEYADLYLDDITLERKHLI
    AAMVDNPNLIERPIAIADGRAVIGRPPERVLNLLGK

    >gi|34496325|ref|NP_900540.1| thiol peroxidase [Chromobacterium violaceum ATCC 12472]
    MATVTLRGNPVDVAGKLPAKGEQAPALQLTGADLAEVSLASYAGKRKILNIFPSVDTPTCATSVRKFNEKAAALADTVVL
    CVSADLPFAQKRFCGAEGIENVVTLSTFRNGSFAEAYGVKLASGPLAGLTARAVVVLDADDKVLHSQLVGEIADEPDYAA
    ALAAL

    >gi|34496529|ref|NP_900744.1| dihydrolipoamide dehydrogenase [Chromobacterium violaceum ATCC 12472]
    MSQQFDVVVIGGGPGGYVAAIRAAQLGFSAACVDAFKNPEGKPSLGGTCLNVGCIPSKALLQSSENFHAVQHDFAKHGIS
    VSGAKMDVGQMLSRKTDIINKNAAGIGFLFKKNKVANIHGLAAFKGRQGEKWVIEVTDGGKVVDTLEAVHVIVATGSSPR
    ALPGLATDNQLVLDNEGALALTAVPKRLGVIGAGVIGLEMGSVWKRLGAEVTILEAAPTFLAAADQQIAKEAFKTLTKDT
    GLDIKLGVKIGEVKAGKKSVSVSYELNGEAVKAEFDKLIVSIGRVPNTQGLGAETVGLALDERGFVAVDDHCHTNLPNVW
    AIGDVVRGPMLAHKASEEGVAVAERIAGQKPHVDFGVIPWVIYTSPEIAWVGKTEEQLKAEGVEYKKGTSGFGANGRALG
    LGQAQGTVKILADAKTDRILGLHMIGPMVSELVSEGVVSMEFKAASEDLARIVHAHPSLSEVIHEAALAADKRALHG

    >gi|34496547|ref|NP_900762.1| HesB-like protein [Chromobacterium violaceum ATCC 12472]
    MALTLSERAAQHVGAFLAKRGKGLGVRLGVKTSGCSGMAYKLEFVDVESSDDVRFESYGVAIYTDAKSLAYIDGTELDYV
    KEGLNEGFRFNNPNVKNECGCGESFNV

    >gi|34496561|ref|NP_900776.1| thioredoxin 2 [Chromobacterium violaceum ATCC 12472]
    MDSDGPRLAGLTIHRKRAAMSYVNLTADNFNANMKEEGLVILDFWAPWCGPCKMFGPVFEAASEKHADIVFGKINTEDER
    DLAAHFNIRSIPTLIAVKDGVMVFNQAGAMMAGQFEQLIQSLRDLDMDKVRADIASQQE

    >gi|34496562|ref|NP_900777.1| glutathione peroxidase [Chromobacterium violaceum ATCC 12472]
    MGWLGRENAMKRWGAMLMLWGQAALAACPALLNHSVPGLMGGQINLCQYADRPLLVVNTASHCGFTPQFTQLESLYKQYG
    PRGLMVIGFPSNDFFQELDKPSEIGAFCQANYGVTFPMAGKGHVRGADAQPLFKDLIAATDDAPSWNFHKYLILPGASKV
    ISIGTRTKPDAPEVVNAFLPYLQPETQAAAKP

    >gi|34496581|ref|NP_900796.1| glutaredoxin 3 [Chromobacterium violaceum ATCC 12472]
    MKPVTMYTTAVCPYCVRAKQLLASKGVGGINEIRIDLDPDARDKMMALTGRRTVPQIFIGDTHVGGCDDLVALNQAGKLD
    PLLAD

    >gi|34496609|ref|NP_900824.1| lead,cadmium,zinc and mercury transporting ATPase [Chromobacterium violaceum ATCC 12472]
    MAQGGGERQTREHAHGRQGGCGHEHQPGDRHGHDHKHDQGHQHGAGCGHSHGHAAPARVQLGEGKGANLSRLQIQAMDCP
    TEARLIEKALAGMDGVVALEFNFIERVLLLRHDLPHLDGVRSAIAKVGMKAVELDAGAQARAPQGHGGRANLLLAASGLA
    AAASEAIAWSLGDGRLEVAALALASILLGGIPTLKKGWIALSSRTLNIHFLMSVAVIGAMLIGQWPEAAMVLFLFAIAER
    LEAMSLAKAGEAVRALMALAPETAWVADGAGWREAQAAEVAVGSRVRVRPGERVPLDGRIADGHSSFNEASITGESLPVD
    KGPKDAVFAGSINGSGVVEIETTAPASGSVLARIIATVRDAQASKAPTQRFIDRFASVYTPVVLALAALFAVAAPLLGLM
    AWHQAIYSALVMLVIACPCALVIATPVTVVSALASAARHGLLVKGGAPLEMAARIDTVCLDKTGTLTLGEPRVTRVAALD
    GGDETAVLAMAAALDSHSTHPLAKAVLDEAARRGIAVPAAEQVSELVGRGVRGRVDGRALQLGSRRLAEEQGALTPALAA
    ELTRMDAAGEGALVLLDGERALGVLAVADQVRPEAAATIARLGEMGVRAVMLSGDSPQVAAAVAAQTGVSAAHGGLLPQD
    KLRFIEQLQACGKVAMVGDGVNDAPALARADLGVAMGAAGSDSALETAGVALMDDKLSRLADLIVHARRTASVLKVNIAI
    ALGIKLVFFGLALAGVASLWMAVFADVGTSLIVIANGLRLARRV

    >gi|34496720|ref|NP_900935.1| copper-transporting ATPase copA [Chromobacterium violaceum ATCC 12472]
    MTQALLTLPVSGMSCAACAARIEKQLNRMDGVEAAVSFANESAQLRYDPDQTKPQQLVDAIVRCGFEVPRQTLELGIGGM
    S
    CAACAARLEKALGRLPGVEASVNFAAESARVDFLPGLMDRDRVLDAVRKAGFEPSLREDGGGEAEAAARYRRELAWFAA
    SALLTLPFLIEMAAMFAGGHHGWLPRMWQLALATPVQFVVGWRFYRGAWQALRGGVANMDVLVALGTSMAWLLSAAVTLL
    GLEDQHVYFEASAAVITLVLLGKLLEARAKGKTSAAIAALVKLAPRTARVERDGELVEVAVDKLQRGDVVVVRHGDSLPV
    DGEVVDGQAWLDESMLTGESRPVAKQAGDKVYAATRNQDGMLKVRATGVGGDTQLAEIVRMVAAAQGSKAPIQRLADRIS
    AVFVPAVSAVALLTFLLTGWLNGDWAQALIHAVAVLVIACPCALGLATPTAVMVGVGNGARRGVLFRNAAALEQAGKVDV
    LLVDKTGTLTEGRPTLRHALALDGDENRLIRLAASAEAGSEHPLAHALLQRAKERELPLLACERFRADVGNGVEAALPGA
    GTVKVGVPSWIGLELPAEAAAWPQEGCTVVAVSLDGQPLGLLALADPLRDSSKGAVKALRGLGVKVVMLTGDHESTARSI
    AAEAGIDEWRAGMKPQDKADVVKYWQRQGGKVAMLGDGVNDAPALAAADVSLAMGAGSDVAIAAADITLMHGDLAHAVDA
    IRLSRASLAKIRQNLAFAFVYNVLGIPLAAVGMLNPVIAGAAMAASSVSVVSNSLLLRRWR

    >gi|34496780|ref|NP_900995.1| thiol-disulfide isomerase and thioredoxin [Chromobacterium violaceum ATCC 12472]
    MKKLLILLSLWLASAAALAGDLPYDELADAKAELSRTLDAAKQGRQPVLLILGANWCPDCRALDAALNSGKSAELLAREF
    KVVKVDVGNFDHNLDIDAEYGHPIAKGIPAAVVLSPDNKVVYATRAGELADARRMSETGIYEFFERVSRLGLTSQ

    >gi|34496878|ref|NP_901093.1| methylated-DNA-[protein]-cysteine S-methyltransferase [Chromobacterium violaceum ATCC 12472]
    MTTAARHGLIDTRFGPVAAWLDARGALLRLLFNPTPEQLAAHACPRDDAALAEVARQLAEYQAGDRQTFDMPLAPQGTPF
    QQKVWAALREIPYGRTVSYGELALALDCPDGARAVGRANATNPIALIVP
    CHRVLGADGSLTGYAGGLPLKAALLRFELER
    SAPPGLFGG

    >gi|34497014|ref|NP_901229.1| iron transport system substrate-binding protein [Chromobacterium violaceum ATCC 12472]
    MNPPLLIACGLAALLAAQAHATRYPLTVDSCNRKVTFLRAPQRAVSHDINLTEMMVALGLQGRMAGYTGISAWNKLNAPL
    KQALGPLPELAGDYPSSEALLASRADFFFAGWNYGLRVGGPVTPASLAPLGIQVYELSES
    CAHVMKRPAASLDDVYRDIG
    NLGRIFDVEPRAQKVVADMRAKVDGVAARVAKRKATPSVFVYDSGEDRPFSAGRLAMPDALIRAAGGRNILADVNASWTR
    VDWETVVARNPQAIVIIDYGKVTAQQKIAFLQKHPALNKMAAVRDKRFIVLPYDSATPGIANADAIGALARGLHPEAFSK


    >gi|34497039|ref|NP_901254.1| thioredoxin [Chromobacterium violaceum ATCC 12472]
    MSDLILHVTDDSFENEVLKADRPVLVDYWAEWCGPCKMIAPILDEVAKEYDGKLKIAKLNIDQNEQTPPKFGIRGIPTLM
    LFKDGQVAATKVGALSKSQLTAFIDSQL

    >gi|34497188|ref|NP_901403.1| hypothetical protein CV_1733 [Chromobacterium violaceum ATCC 12472]
    MPEAWAPVRPETPPAPELLYWNAELADELGLDAGQTDKGELARLFSGADIPEGAQPIAQAYAGHQFGGLSPSLGDGRALL
    LGEVTDRNGQRRDIALKGSGQTPFSRRGDGKAAVGPMLRELIVGEAMQALGIPTTRALAVTTTGEPVYRERPLPGAVLTR
    VAASHLRVGTFQYFAIRGETAMLNKLADYTIARHYPQLAGRDGRHLALLAAVAERQAALIARWMHAGFIHGVMNTDNMAL
    SGETIDYGPCAFMDAHYPGTVFSSIDHQGRYAYGNQPAIAQWNLARFAETLLPLISPDDPAAAVPAATEIVEGFEDLYQR
    RWLEQARRKLGLEGERDDDQALADDWLMLLAAHGVDHTLAWRYLADEAEGKGERLAALFPSPDALTPWLKQWHARHVPRT
    RRPPDIAAAMRRESPLYIPRNHLVEEALDAASERGDMGPTLKLLEALHQPFAERDGLDRYAQPAAAELAEGYRTF
    CGT

    >gi|34497227|ref|NP_901442.1| hypothetical protein CV_1772 [Chromobacterium violaceum ATCC 12472]
    MNRIAIPAAEAIPAASQPLLAAVQQQLGMVPNLMKLLAHSPAALEGYLALNGALGKGKLSAGLRERIALAVAEFNGCDYC
    LSAHSYLAKHVAKLGDDEIAAARDFASADARQAAALRFARQVAEQRGRVEDAELAALRGAGFDEAETLEIVLTAALNILT
    NYVNNAAATAVDFPLVQTRA

    >gi|34497350|ref|NP_901565.1| thioredoxin-disulfide reductase [Chromobacterium violaceum ATCC 12472]
    MGHYLSDNPAPEDVAALPGLTLLEFGVDWCPHCQGAQPLLAQYLASRPPLRHLAVEDGKGRRLGRLYGVKLWPSFILLRD
    GAEIGRVVRPQSLDQLEALSAGV

    >gi|34497491|ref|NP_901706.1| peroxiredoxin/glutaredoxin family protein [Chromobacterium violaceum ATCC 12472]
    MLQNREGQRVPNVTFRIRENNEWKNVTTAELFDGKTVALFSLPGAFTPTCSSTHLPRFNELAPAFFANGVDAILCVSVND
    TFVMNEWAKDQEAQNIVMIPDGNGDFTEGMGMLVDKQDLGFGKRSWRYSMLVKDGVVDKMFVEPQEPGDPFKVSDADTLL
    NYINPSAKKPDQVVVFTKVG
    CPHCARAKAVLAENGYDFVEVPLDNKIRGKVLGAVSGAMTAPQVFINGELIGSADEVEKR
    FAK

    >gi|34497492|ref|NP_901707.1| dihydrolipoamide dehydrogenase [Chromobacterium violaceum ATCC 12472]
    MKTIHIDVAVIGAGTAGLAAYRAAKAGGASALIIEGGPYGTTCARVGCMPSKLLIAAAEAAHHAGHTDMFGVHVDGGVRI
    DGREVMARVRSERDRFVGFVVRSVDGIPAEDKLPGYARFVDNTTLQVDDHTIVQAKRVVIATGSSPAVPAPFKAFGDRLI
    VNDDVFEWDALPQSVAVFGPGVIGLELGQALSRLGVRVRVFGLGGGVGPLSDPAVRGYARQALSEQFYLDPDAKVLEMAN
    DGDAARIRYVNLDGEEVEERFDYVLAATGRTPNVRSLGLENTSVRLDARGVPLFDPETLLCVGAPVFIAGDANNILPLLH
    EAADEGKTAGANAAAYPAVSAGLRRSPIAVVFSDPQMMMVGRRFADLPEGDFAVGEVSFEDQGRSRVMGVNKGLLHVYAD
    KATGRFLGAEMIGPRAENLAHLLAWSHQQGLTVEQMLDMPFYHPVIEEGLRTALRDAAAKLARD

    >gi|34497497|ref|NP_901712.1| cation transport P-type ATPase [Chromobacterium violaceum ATCC 12472]
    MSENCFHCGLPVPAGASFPIRYRQREEPACCAGCQAVAATIIESGLSDYYKHRTEGAARAEALPQAVLEQIKLYDSEELQ
    RGFVRVESENIREASLMLEGIT
    CAACIWLNEQHIRRLPGVLGVDINYSTQRARVRWDNGRVQLSAILEAVAAIGYRAHPY
    DADRQEKLQQKERKQALTRLWVAGLSMMQVMMYAVPVYLAPDGDIAPDFLWLLHWSSFILTLPVLLYSALPFYRNTWRDL
    KTGRVGMDTPVSIGILTAFAASFWALIHKVEHGIYFDSVSMFVFLLLGGRYLEGIARRKAGAASESLVKLVPAFAHRLDN
    WPHSRDSREATVAGLNPGDVILVKPGETIPADGVVLDGRSASNESLLTGESRPIAKAPGDAVIAGSVNTSSPLVLRVEQA
    GQSTRLAGIVRLLDQALAEKPRLAVLADRFASWFVAFLLLAAAGSYIGWHFIDPGRALWIMVAVLVISCPCALSLATPAA
    LTAASGRLASLGVLTTRGHALETLAKADDAVFDKTGTLTHGQMRLLETRGPLDAHRALAVAAALEQGSEHPLAQAILAAA
    PADRPQADGLINHPGGGVAGGVDGREWRLGSAPFIAAWLGREVDEDAGWQPDCTQVLLADADGVQARFAIGDACRDDAAA
    LMAELTRRGLAVHLLSGDGEGPVAGLAARLGITRWRSRATPEDKLAYVAALQAKGRRVLMVGDGVNDAPVLARADVSIAM
    GGGTDVARASGDMVLMGDRLGLIGDSLVLSRRALAVIRQNLVWAAGYNVVALPLAMLGHVTPWLASLGMALSSLLVVGNA
    LRLVKRNP

    >gi|34497517|ref|NP_901732.1| hypothetical protein CV_2062 [Chromobacterium violaceum ATCC 12472]
    MTLTLYFREYCSLCHQMLAELAPWRERHGFELEVVDVDADPALEARFNELVPVLMDGETEICHWHLDGARLAAHLGEIG

    >gi|34497780|ref|NP_901995.1| protein-methionine-S-oxide reductase [Chromobacterium violaceum ATCC 12472]
    MEKAILGGGCFWCLEAAFSQLKGVERVVSGYCGGHTDSPDYRQVCSGDSGHVEVVEISYDPALIDYATLLQVFFAVHDPT
    TLNRQGHDVGTQYASAIFYLDETQRECARRVIAQLDAEQIFDAPIVTRVESAPRFHPAEDYHQNYYAQNQQQNYCQLVIS
    PKLAKIRRRFSHLLQN

    >gi|34497808|ref|NP_902023.1| thiol:disulfide interchange protein precursor [Chromobacterium violaceum ATCC 12472]
    MQAYLHSFYRSAWLWLASVIACLGLALPAHAVNQDDLLPPEQAFAAQVSRSGDQLQLTLEVAPGYYLYRDRISISTTPAD
    LAGKPTLPAAQEKNDPYFGKQQIYHGKQLITIPLAAGAPADFQLNVKLQGCAEAGVCYPPYTHKLKVGQAGAAGNKLSAW
    TEVDSSGKASAGNSELAARGWLATLGTFLLAGLGMAFTACMYPLLPIVSSLIAGQGATLSRGRGFLLSLLYVQGLALTYT
    AVGVVAGLTGSLLTVWLQQPAVVLSASALMVVFALSMFDLFSIQLPSALQSRLADTSNRLTGGKAATVFLMGALSALIIG
    PCVAPPLALALGYIGSTGDAVLGGAALYAMAMGLGLPLIAIGTFGGHVLPRAGHWMKAVKSAFGVVMLGLAIWLATPFLP
    PPLVMLLWAALLIGSAVFLGAFDSLSSATKASARLGKALGLLLFLLGGAQLVGLLSGADNPRYPLKLLAASSAEGAVQQH
    FQPIRSSAELDAKLAEAKAAGKPLLLDFYADW
    CVACKEMEADVFPQQQAAAQMQRFVLLRADVTANTPEHQALLKRFGLF
    GPPGIILFDSQSRESNRVVGYTPADAFARELAKVAN

    >gi|34497948|ref|NP_902163.1| organic hydroperoxide resistance protein [Chromobacterium violaceum ATCC 12472]
    MSIETILYRTQATVSGGREGNAESSDGALKVQLSTPRELGGAGGPGTNPEQLFAAGYAACFLGSLKFVAAKRKTTLSADA
    SVSCGVGIGTLPSGFGLEVELQIRLPGLSDEEARQLIEQAHIV
    CPYSDATRGNIDVRLRLA

    >gi|34498092|ref|NP_902307.1| disulfide isomerase/thiol-disulfide oxidase [Chromobacterium violaceum ATCC 12472]
    MKPACAVAIAVGHASLSAAAAAAAAWPAPIQALEQQGYEILGRFDGPSGMAGYAALRLGRPQTLYLTPDGKYAIAGTMTD
    GGGENWNQAGVDQRFSDAMWEQLQGSAWIADGSRTAERVVYLFTDPN
    CPYCRQFWRDARPWVRSGKVQLRHILIGILQAD
    SRGKAAAILADADPARALARHEGGADTRPLGQPPAAVEARLDANHRLMERLGAFATPAIYYRAADGSLQKAQGAPGAAAL
    PKILGPR

    >gi|34498208|ref|NP_902423.1| disulphide-isomerase [Chromobacterium violaceum ATCC 12472]
    MKRTLLAMALALAGLMPLAHADVSDGHALPPGISWQQGDVPAAFARAKAENKPVFLYWGAVWCPPCNQVKSTIFNRPDFI
    AATRQFVPVYLDGDSENAQQLGEKFKVRGYPTMILFRPDGAEITRLPGEVDPERYLRTLQLGLTAVKPVKALLSDALAGN
    TLAAADWQLLADYAWDVDRGQLLPEKDVPATLAQLAERVPAEPAAVATRLQLKALAAQAGEKAPPAFDKRQARGRLLRVL
    ADDKLSRANADVVIYAASDALKLLGDDAALRQAFDAQLKKLEADSTLSWSDRLGAASTLLSLYKQQHPKQPLPAGLVADV
    KAKAAEADKASANPYQRQAVITAAGELLSDAGLLDESDTLLKGELKTSHAPYYHMLILASNAKERGDKAAALDWYQKAYQ
    ASEGQATRLQWGASYVSNAVELAPQDAGRIELAASEVFADAGKSGSAFYERSRRSLEKVAGRLKTWNQDGKHADAVGRLA
    GQLNGVCEKLSAEDAQKPVCDGLVKELKS

    >gi|34498211|ref|NP_902426.1| hypothetical protein CV_2756 [Chromobacterium violaceum ATCC 12472]
    MQARLKWVDGVCFMGETGSGHAVVMDGAPEGGGRNLGPRPMELVLLGTAGCTSYDVITILKKSRQDVRDCWVDIQADRAD
    ADPKVFTRIHFHFVVVGRELKPDAVERAIKLSAEKYCSASIMLAKTADITHDFELRED

    >gi|34498268|ref|NP_902483.1| thioredoxin reductase [Chromobacterium violaceum ATCC 12472]
    MNSHLFDDRKTHMSAPRHSPLLILGSGPAGYTAAVYAARANLKPVVITGLAQGGQLMTTTDVDNWPADAEGVQGPELMQR
    FQQHAERFGTEILFDHIHTTHLSEKPIRLVGDAGEYTCDALIIATGASAQYLGLPSEEAFAGKGVSA
    CATCDGFFYRNQD
    VAVVGGGNTAVEEALYLANIARHVTLIHRRDTFRAEKILVDKLMSRVAEGKISLKLNATLDEVLGDDSGVTGVRVKLNDG
    GSENLALTGVFIAIGHKPNTDIFKGQLEMDSTGYLITKGGRDGNATLTSIDGVFAAGDVQDHIYRQAVTSAASGCQAALD
    AERYLDSLK

    >gi|34498270|ref|NP_902485.1| bacterioferritin comigratory protein [Chromobacterium violaceum ATCC 12472]
    MTGTPCPDFTLPGTAGADFQLSSSRKPLVIYFYPKDNTPGCTNESMAFRDLHPEFAALGAEIVGISRDSLKSHQNFKAKL
    ELPFELLSDSEETACSLFGVIKMKNMYGKQVRGIERSTFVIDASGKVSREWRGVKVPGHAEEVLAYVKTLK

    >gi|34498392|ref|NP_902607.1| hypothetical protein CV_2937 [Chromobacterium violaceum ATCC 12472]
    MKLHYFYDPLCGWCYGASPLLQAVAALPGVSVEMHAGGMLDESEGRTITPDWRSYVMPHDKRIAQMSGQPFGDAYYDGLL
    NDIGAPLASNPAIAAVLAADTLGIAPLAMLARIQRAHYQEGRRIAEFAVLSELAVELGADAGAFQAAWQPAREDAEKHID
    DTRRRMGQLGLRGFPSAVLEQDGRLERLELSGWFGKPAQLAAALAERLPKPAAGGDDALFCTPESCR

    >gi|34498574|ref|NP_902789.1| protein disulfide-isomerase [Chromobacterium violaceum ATCC 12472]
    MNKRMKTLALSSAMLMSLAACSQAAGGNVEDVKKAFLNHFPGKQVKSVSATPVKGIYELVVDGRQVVYVNSDASYLFVGD
    LIDAKNKESLTEKKMAELSKVDFNALPFQYAFKDVRGKGERKMAVFTDPD
    CPFCKKLERESLKDIDNVTIYTFLYPLTQL
    HPDAMRKSKQIWCSADKAAAWTAFMRDGKPLTGPDNCDTPLDKIQALGEKMGITGTPALVFANGRMVPGAIDGGDIEQLL
    NAK

    >gi|34498648|ref|NP_902863.1| protein-disulfide reductase [Chromobacterium violaceum ATCC 12472]
    MGLNITNRQGFLLVAAACAGAIGFALFAQYQLGEEPCPLCILQRIGVMAVGALALLAALHNPGKTGAKVWGGLMTLAALS
    GAGVSLRQLWLQSLPADQVPQ
    CGPGLEFLMESFPLWEVLSKVLKGSGECAAIQGRFLGMTMPFWVAVFFAGVIVWTLWLV
    GRRRRG

    >gi|34498667|ref|NP_902882.1| transcriptional regulator [Chromobacterium violaceum ATCC 12472]
    MTIEKTDAEWRAQLTSEQYRVARQAGTERPFSGEHYFHNKKGDYFCVCCGTLLFHSDTKFDAGCGWPSFWAEAAGANIAR
    LTDTTHGMVRVEVRCSHCDAHLGHVFEDGPEPTGERY
    CINSVCLDFKAE

    >gi|34499010|ref|NP_903225.1| glutathione peroxidase protein [Chromobacterium violaceum ATCC 12472]
    MSIYDFSFRRLDGSEQAMADYRGSVLLLVNTASRCGFTSQYAGLEALHRRFGPQGLAIIGFPCNQFGAQEPGDAGEIGAF
    CQKNYGVDFAMADKVDVNGANAHPLWQYLKRQKRGLLGQAIRWNFSKFLVDRQGRVVARFAPFTRPEKLAARIEALLK

    >gi|34499043|ref|NP_903258.1| hypothetical protein CV_3588 [Chromobacterium violaceum ATCC 12472]
    MSKMSRILQDAHQRAEQMSLPYSGAVLPDEAYELMQGLPKAVLLDVRSHAEWQFVGTVPGAVNIEWRSYPGMEPNPNFLA
    QLTHQVDPEAVLLVI
    CRSGARSDQVARLAAENGYSEVYNVLEGFEGDRDGEGHRNSVGGWRWRGLPWVQG

    >gi|34499075|ref|NP_903290.1| hypothetical protein CV_3620 [Chromobacterium violaceum ATCC 12472]
    MSIQQDIQQTVADNAVVLFMKGSAQFPQCGFSSRAVQILKACGVDNFLTVDVLRDPDIRQGIKDFSNWPTIPQLYVKGEF
    VGGSDIMYEMYQNGELQDLLKDL

    >gi|34499126|ref|NP_903341.1| methylated-DNA-[protein]-cysteine S-methyltransferase [Chromobacterium violaceum ATCC 12472]
    MDYPVVIAAPFGRLGVRCEAGELRELRFLPAGMALRPPAPGSLEAEVARQLDAYYADPRHVFTVPRRLLGTPYQLRVWQR
    IAAIPCGETRRYQDLSRELSSSPRAVGGACGRNPIPVIVP
    CHRVVASAGLGGFNQSTGDETLDIKKWLLRHELG

    >gi|34499149|ref|NP_903364.1| hypothetical protein CV_3694 [Chromobacterium violaceum ATCC 12472]
    MTEAATEMPSPINFTESACAKVQDLIAEEGNPDLKLRVFVTGGGCSGFQYGFTFDEIANEDDTAIERQGVTFLVDPMSYQ
    YLVGAEIDYQESLEGSQFVIRNPNATTTCGCGSSFSV

    >gi|34499194|ref|NP_903409.1| peroxidase [Chromobacterium violaceum ATCC 12472]
    MAVLVGKQAPFFAGEKTFSAVLGNGEIVDNYSFKQATAGKYAVVFFYPLDFTFVCPSELIAFDHRLAEFKAKNVEVIGVS
    IDSQFTHAAWRNTPVEKGGIGQVGYTLVADIQHDLCKAYDVEADGGVAFRGSFLIDKSGVVQHQVVNNLPLGRNVDEMLR
    MVDALQFTEEHGEVCPAGWNKGKKGMKPSAEGVASYLAENAKDL

    >gi|34499242|ref|NP_903457.1| glutathione peroxidase protein [Chromobacterium violaceum ATCC 12472]
    MTTLYDFSAQRADGAEQALSAYEGRVALLVNTASECGYTRQYAGLQELQDYFAGQAFVVLGFPCNQFGGQEPGGEDEIVD
    FCRSRFGVSFPLFAKLQVNGDGAHPLWRWLTQADSDRPHPIKWNFTKFLVDGRGRVVKRYEPAVEPHELVDDIKALLAR

    >gi|34499453|ref|NP_903668.1| thiol:disulfide interchange protein dsbA precursor [Chromobacterium violaceum ATCC 12472]
    MKKWLLLVMLAVSGMANAAIQLGKDYTMLSTPQPVADPKKVEVIEFFSYHCIHCYDDDPAFNAWSKTLPADVSFRKEQIV
    WQKSMEGFARMFATFNATGTFDKLHRAAFDAQIKQRVDLSKPEQFTGWIKQQKGVDSAKLLQTYNSFGINAQVARATKIT
    RDYQIQGTPTVIVNGKYVVVTATPERMIQVMNELVAKARAEKK

    >gi|34499460|ref|NP_903675.1| stringent starvation protein A [Chromobacterium violaceum ATCC 12472]
    MMTLYSGITCPFSQRCRIVLFEKGMDFEIIDVDIHNKPEDLAVMNPYNEVPVLVERDLILHESNIINEYIDERFPHPQLM
    PADPVMRARARLFLYRFENELFIHVKTLEAGATGKEATKAREAIRDGLTTIAPIFSKQKFMLGDDFSMIDVAIAPLMWRL
    EHYNIDLGKSAAPILKYAERIFQRQSFIDSLTPSEKAMRK

    >gi|34499550|ref|NP_903765.1| rhodanese-related sulfurtransferase [Chromobacterium violaceum ATCC 12472]
    MISQQEFYEAKLAYEIDAADVAQALAGGDRSLLLIDTRSVEAFDHETIPGALSRPHRLMTAENTADLPRDITLVAFCDGI
    G
    CNGSTKGALRLTQLGFKVKELQGGLDWWKRDGYATTRDKGCGKEVCDAC

    >gi|34499700|ref|NP_903915.1| thiosulfate sulfurtransferase [Chromobacterium violaceum ATCC 12472]
    MYTTLISCRQLMEAPAESLIVLDCRFQLDNPDYGHAAYEQGHIPGAHYLHLDYHLSGSKNGQNGRHPLPDGQRLAVDLGA
    LGVGENTQVVAYDDGAGQYAARAWWLLRWLGHDKVAVLDGGFAAWKAAGGAVDAEPPQRRPCRFSIRRPLQATVDAGAVQ
    ANLDEKTFTVVDARSPERFRGLGETIDPVGGHIPGAANRFFMDNLDAGRYKPAARLRAEWEALLGEGFDPAAIVHQ
    CGSG
    VTACHNLLAMEIAGLPGSRLYPGSWSEWCSDPARPVAR

    >gi|34499712|ref|NP_903927.1| thioredoxin [Chromobacterium violaceum ATCC 12472]
    MKKGLIIALALLVAAGAAYKLMFSGSPAPEVKLTSLTGAVTSTSALKGKVVLVNFWATSCPGCVEEMPEIKKLHQEYGGK
    GLNVLAVAMSYDPPNYVQNFVAKNQLPFFVALDPQGATAKAFGDIQLAPTTFLIDKQGNIIKRYVGVMNFAEVRKLIEQH
    L

    >gi|34499713|ref|NP_903928.1| molybdopterin biosynthesis MoeB protein [Chromobacterium violaceum ATCC 12472]
    MEDRELDDEALLRYSRHILLPEIDIAGQRRLLAARALIVGAGGLGSPAALYLASAGVGRITIVDDDAVELSNLQRQIAHD
    TASLGQGKAASAARRMLALNPTIEARPLAERLSGQRLMDEVAAHDLVLDCSDNFATRHAVNRACVAARVPLVSGAAVRFS
    GQLAVFDSRDAASPCYHCLFPDEGEASDGP
    CATFGVLSPLVGAIGSLQAVEAVKLLAGVPPALGKLTLYDALDGSFKQIR
    VPRDPACAVCGGA

    >gi|34499734|ref|NP_903949.1| thioredoxin-related transmembrane protein [Chromobacterium violaceum ATCC 12472]
    MPLAAHAAPTLEQSRFADLNAKPVAVSAYKGKVTVLNFWATWCGPCREEMPMLNGLRKKLSPKGVEVVGVALDSKEQVEP
    FVKQLKIGYPILLGNDDTLDLMRGLGNKTGGLPYTLVLDRQGKVAATLTGKLDEKKLEAAVKPYL

    >gi|34496974|ref|NP_901189.1| hypothetical protein CV_1519 [Chromobacterium violaceum ATCC 12472]
    MSRFIDYPTLAPQGYQAQAGLERYIRGCGLDHALLELVKTRVSQLNGCAFCIDMHTKDARAAGETEQRLYLLSAWREAPC
    YTERERAALAWAEALTRVASGHPEEALRTELARHFDDKQIVDLTWTIVAINGWNRISIGCGTPAGGYQPGQYAL

    >gi|34499022|ref|NP_903237.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Chromobacterium violaceum ATCC 12472]
    MTKTIMLANPRGFCAGVDRAIAIVERAIELYGAPIYVRHEVVHNRFVVDDLRGKGAVFIEELKDVPPGSTLIYSAHGVPL
    SVRAEAEALGLTVFDAT
    CPLVTKVHVEVKRMNKAGMEIIMIGHAGHPEVEGTMGQVDAGIYLVQTVDDVATLRVVNEDQL
    SYVSQTTLSVDETRDIIAALKARFPNIHSPKKDDICYATQNRQDAVKLLADQCDIVVVVGSPNSSNSNRLREVAALKGVD
    AYMVDNASLLEPEWFAGKRRVGVTAGASAPEVLVQAVIDRIKAFDVTQVTELPGVEESTVFALPPALRPLF