Chloroherpeton thalassium ATCC 35110 uid59187

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|193213760|ref|YP_001994959.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chloroherpeton thalassium ATCC 35110]
    MKQKKGIILLLALMIATGAFTAYTMNQPESTMNGQAIALKDDGKLAPNFDLETIDGKKLSLSDYKGKAVILNFWATWCPP
    CRAEIPDMIELQEEYGGENFTFIGVAVGDQLERVKRFVENSGINYPVAMGNNAITDDYGRFIEGGMRGIPTTFVISTKGE
    ILGHFVGARSKEAFEAAIKDALKK

    >gi|193213775|ref|YP_001994974.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chloroherpeton thalassium ATCC 35110]
    MNRQVLQKWIFPVILLVIFSFVSLAAAAQISLQPGDKAPDFSIPDHDGESYRLSKRKGKVGFVIVFLSTECPVSNAYNFR
    LIKLAKYAKENNLDFIGINSNQTESFEEVYTHAKAKSLNFPVLKDEENKVADMYGASVTPEAFLIDKNLIVQYHGPIDDN
    QREERVTEPYLHDAIEQLLNGKHISPDNVKPRGCIIKRFR

    >gi|193213811|ref|YP_001995010.1| HesB/YadR/YfhF-family protein [Chloroherpeton thalassium ATCC 35110]
    MQMIDIKITKAAEEKIHDLTTSGEVEQGTIRVATGCAACGGLSFALDFNTKKKPDDALVPHDKWEFAVGREVQELVENIT
    IDYVENEFGGNFIIETAYGTSACWW

    >gi|193213821|ref|YP_001995020.1| hypothetical protein Ctha_0102 [Chloroherpeton thalassium ATCC 35110]
    MRHKKISSEKQPSFAMKKRLMPVAFYFCLITLISPLSALQAQPKLKASSTMENLGTLYDGARKTAAFTLTNVGKDTLKLF
    KVTTS
    CGCTTLEEKPDYILPGKSWKMEVELNSTGLKGEVQKSVSLLTNEPGTESTHRFSLKANVISEFELLNKQDIVQLG
    EFILGGRAKRSAELKNITNEAILIMKTRFDNEQIEAIAENKIVEPGETLEVTFDFSISEVGTFTDVVYLVTSSMNQQYVP
    VKLTYTVVARQ

    >gi|193213855|ref|YP_001995054.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Chloroherpeton thalassium ATCC 35110]
    MPNLPVLVIGGGPAGLEAARGVADLGYKAVLVEKESVLGGRPILESYAALTPDMRNTEEAMNEMIGRISNNEAVDIRTGA
    TVTAVEGEAPNFKVTLQNGSGAETLDVSSVIVSTGFQHFDPGRETQMYGYYEFDDVITLTDAEKMLKAGKFVRPSTGEAP
    KRVAFIQ
    CVGSRDRQIGNKWCSKVCCGIASKQASEIRHFVPDAKLFIFYIDLRAYGFWEDELYWKAQEENKVNYIRGIVT
    EINKRGESVVVKGEDTTMGRPMEIPMDMVILSVGMEPSEGTKDMSKLFNLPLESHGYIATTGGALNTVETTVPGVFIAGA
    AGGPADLEDSVSMAGAAASRACAFIRKSEMAVA

    >gi|193213858|ref|YP_001995057.1| thioredoxin [Chloroherpeton thalassium ATCC 35110]
    MAELVLCVFTHPACPRCPAAVEMAWRLSEEFRDMKLKTVKLENKEGLSFAQKLHVKTIPTMIFFKNGKEEKRFVGLPKPE
    ELKAEFVRLSDTET

    >gi|193213860|ref|YP_001995059.1| DsrE family protein [Chloroherpeton thalassium ATCC 35110]
    MVDEGSVVIFVTSGTQTPQRCGTPFYMASISASMDHEVTMIFQIDGVLLMKKGQTDNIAAKEGGKKIIDFIREAKEAGVK
    MHV
    CAAAMQLHDMKESDLIEECDGLIGASFMTEMAMDSDLTLIY

    >gi|193213891|ref|YP_001995090.1| OsmC family protein [Chloroherpeton thalassium ATCC 35110]
    MELEVFFEDNLKVNAKLGDQIIRTDQSIAAGGDGSAPAPFELFLASIGTCSGIFVKHFCLQRGIDPTGIRILQKHDFNPQ
    THMIEQINIEVHLPEGFPEKYKDVIIKVVDQCAVKRHLQHPPVFNVTTVS

    >gi|193213952|ref|YP_001995151.1| cytochrome c biogenesis protein transmembrane region [Chloroherpeton thalassium ATCC 35110]
    MLKRPFKNAFWFTAFFSVLSLFFAKNAAAQFPDFGDGKKLVQPSLVVGTENFREPFIIGIRFKLEPEWHIYWKNAGDAGT
    PVEVEWNLPDGFRVSELDYPVPIKFVLSGVVGYGYTDEVVLLAKVEPPKNYSPKKAPEISAKLSWLVCRESCIPGEGEVS
    LNLETLSQKDVAEGKKLIEKFEAKLPGQSGNLDIKLEQAVAKGSGKNVTAELRFSGKQASEITDFFPDILENAFIGYNDI
    QVANNTISFPMQLSAPDAELPEIRGLLVTETHGYEFSATLKAATESLLDDSFQVAGERPDESPLWMILLLAFVGGLLLNI
    MPCVLPVLSLKVLSFVEHSSMEKSHTRYLSFIFALGVLVSFWVLALGVGVLQNAGEQIGWGFQFQSPWFVVGMSVVVFIF
    GMNLVGVFEFASPNVTGDVSKTLSRHDALGAFMNGVLATTLATPCTAPFLGTALGFAFSQPFYMIFLIFSLVALGLAAPY
    VILSLNPAWLKFIPKPGVWMERFKQAMGFLLFATLVWLLSVLGSQTGATGILAALTLLLGVSVGLWLIGAFIDYGTPATK
    KFMIWGIALLLAGASYYLGFEKWFPIRETAQTQTEAAKPHDGLIDWKPFSIATVEKEVSAGKPVFIDFTADW
    CFTCKVTE
    QTVLHTDAVSGKIKELGIVPIRADWTNRNDEITGLLKKFGRSGVPLYVVFPAGKLSEPIVLPEVVTPELLIEAFEKAVSK


    >gi|193213953|ref|YP_001995152.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chloroherpeton thalassium ATCC 35110]
    MSYQKLKELRSTLSKFSAALIAFMLFTAVVLVTVTNASAPESEVGKLAPDFSLKDTDGKTHKLGDYKGKTVVLEWTNPGC
    PFVVGHYKTGNMQQLQEKYTEAGVVWLTVNSTNPAHPNHLSAEALAEKFQSWESHASANLLDEDGKVGELYGAKTTPHMF
    IIDKNGKLAYAGAIDDDRSTNGGANASVNYVAQALDELLAGKSVSVKQTKQYGCGVKY

    >gi|193214053|ref|YP_001995252.1| Rhodanese domain protein [Chloroherpeton thalassium ATCC 35110]
    MKHINPEQALEIMKMRPEFQVLDVRTRREFGVRRLACAMNIPVDELSRRYHELDEDAEIIVLCEHGLRSQRAALLLEDAG
    FEKIYNVLGGLSRWKAQTVSG

    >gi|193214220|ref|YP_001995419.1| methionine-R-sulfoxide reductase [Chloroherpeton thalassium ATCC 35110]
    MAQTTKYHAKWLAALFLLGSIAACQSTASRTEASTADQAFSCQIKPENREDMPDKVIKTDEEWKSKLTPLQFEVTRNKGT
    ERAFTGKYYNHKGKGIYTCACCGNELFTSNEKYDSGTGWPSFWKPVDNDKIEIKKDFSYGMTRVEVLCKRCGAHLGHVFE
    DGPEPTGLRY
    CINSVSLDFEAANAEKEK

    >gi|193214271|ref|YP_001995470.1| heavy metal translocating P-type ATPase [Chloroherpeton thalassium ATCC 35110]
    MATSKGKGNLESITLSVAGMSCMNCVRSVASALNNLAGVQNAKVSLEEHSATVEYFSDLVSVDDLKTAVRNAGFSAEKQE
    AGLKKPIEAPLAFALELPVFSAETTMKQAAIAKIETAEKNAEPSDGKSATESLTLLIGGMH
    CAACVGKVETALQRTNGVR
    RAAVNLAMETATVEFFPDQCTPEALLETITGAGYEATLPDTNSAAEAAEADEREKEAAFERHKKLTIFSAVLTAVIMAIS
    MSMMLPAIGKTLNAQVANYLLFFLTLPVVAWCGRQFFISAWKNLLHFSASMDTLIAVGTGSAFLYSTAVTFFPDLFSNIG
    RAGHVYFDTSATIITLILFGRLLEQRAKTRASEAVKKLAKLSAKTARVVRNGIEHELPIAQVMKGDTLIVRPGEKIATDG
    KIIDGASSVDESMMTGESLPAEKTADDEVIGGTLNKNGSFRFRATKVGKDTMLAQMIRLVGEAQGSKAPIQRLADTVSAY
    FVPTVVLIALATFGIWFFAAAPEIRLSMALVNFVSVLIIACPCALGLATPAAVTVAAGRGAELGILFKNAESLETAEKIQ
    TVVLDKTGTITEGKPRVIDFEVAHENESGINELLSLLLAIESRSEHPLADAIRTYAESQNAKPLLLEHFQAIEGKGAKGS
    VSGKSVAVGNAALMADEKIQIPFELAEKASRFAKDGKSVVFMGINGKAAAVMSLADALKPDSKQAVTMLKSLGMKVIMLT
    GDGKETAAKIAHEAGISEFRAEVLPAEKVEMVKSLQAKDQRVAMIGDGINDAPALAQADVGIAIGTGTDIAISAADVTLV
    KGSLLTAAETFRLSRRTMHTIRQNLFFAFIYNTFGIPIAAGVLYPFAGILLSPIFAAMAMAMAMSSVSVLGNSLRLKKYQ
    P

    >gi|193214337|ref|YP_001995536.1| Rhodanese domain protein [Chloroherpeton thalassium ATCC 35110]
    MLSGTTLAVFFQRVESRCCFISGVDSRDVVFYLKKMDIHFNRKKNMLNFLLKHLRSLELVEQFVENAHPACTSLEHHTLF
    ELMQSSALETLRIFDVRAFQEFEISHLEQAISVPPETEVSHFFETFENELSGKKLVFY
    CSVGLRSAEFIGKVQNKCLNAG
    ALSVHNLKGGIFRWYNAGLPVVSANGKTDELHPYNSFWELLVEKRAQ

    >gi|193214342|ref|YP_001995541.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chloroherpeton thalassium ATCC 35110]
    MIAEGKKAPDFTLPDSTGKEVSLSDYAGKKVLLVFYPGDDTPVCTTQLCSYRDNFSAFTERGITVLGISTNTIESHESFA
    SRNELPFTLLSDSKKKVSEDYGALNFLGMSERAYVYIDEAGTVRLSFSELLPLFYRSTQDLLAQIDSFSNNA

    >gi|193214433|ref|YP_001995632.1| UBA/THIF-type NAD/FAD binding protein [Chloroherpeton thalassium ATCC 35110]
    MGTKILIPTALRQYAGGHDVVEVSAGDVAKALAELTSLYPALKKNLFAENGKLRSFINVYKGEENIKNLNQLETTIEEGD
    ELLIVPSIAGGAPADLEVLHELSNEEIQRYSRHLLVPEFGMEGQKKLKQASVLMIGAGGLGSPLGMYLAAAGVGKLGIVE
    YDTVDYSNLQRQLLYKTADVGRSKAEAARDTIKSINPFVEVEIHQVPLTSLNALDILKHYDVVADGTDNFPTRYLVNDAC
    VMLGKPNVYGSIFRFEGQVSVFHLNDDTACYRCLYPEPPPPGLVPS
    CAQSGVLGVLPGIIGSLQAIEVIKIITGIGEPLA
    NRLITFDALKMKFRELKLKKDPECLLCSEHPAITELIDYEQFCGMPAHDRIEKKPLAKVSTDPNEITVHELKSRFDRGEK
    PFILDVRNPTETQICCLEETTLIPLNELPARLHELDAQLEIIAL
    CRSGARSDNAAEFLRKNGFKNVKNLVGGILAWSKEI
    DPTMPTY

    >gi|193214449|ref|YP_001995648.1| methylated-DNA/protein-cysteine methyltransferase [Chloroherpeton thalassium ATCC 35110]
    MQTQKKEPPNQELVSFYDRVYELVRQVPFGKVTTYGAIAKALGAASSSRIVGYALKCAPMESVPCHRVVNRFGALTGKMH
    FGDPNLMRKLLEREGISFSEDGYVKLDEHFFDVANLFKQ

    >gi|193214686|ref|YP_001995885.1| iron-sulfur cluster assembly accessory protein [Chloroherpeton thalassium ATCC 35110]
    MSESSVQENQSTKNSAPITITDAAASEIRQVAEANKVPEGYTLRVALSSGGCSGFSYAMGFDQTRDGDHHFSINGVDLII
    ASQHLQQLAGTTIDFKDSPEGRGFLFDNPNIQHTCGCGSSSSCH

    >gi|193214902|ref|YP_001996101.1| redox-active disulfide protein 2 [Chloroherpeton thalassium ATCC 35110]
    MLNIEVLGLGCPTCYRLAELCREVVLEKGVEATVESITDEKKISAYGVLQTPTLIINGKIMLSGKLPTKAILEKWFSQEN
    SA

    >gi|193214905|ref|YP_001996104.1| redox-active disulfide protein 2 [Chloroherpeton thalassium ATCC 35110]
    MKTIKILGSGCAKCAQVEAAVKEVIAAEHIEATVTKVEDIQQIMSYPVMMTPAIVVDEVVKIAGKVPNKQEILAALA

    >gi|193215036|ref|YP_001996235.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chloroherpeton thalassium ATCC 35110]
    MATHIKFLLSVWIFFLVGCGSGKEGLEIGDKAPDFSLPSDDGQLISLSEYKNHQIVVLYFYPKDNTPGCITEACSFRDRV
    EEYKAAGVAVIGVSTDDAESHKDFRETHKLNFTLISDTKKKTTEAYGALTSLGFARRMTFVIDKSGIIRKIYPDVTPSGH
    ASEVLEFIKSLE

    >gi|193215110|ref|YP_001996309.1| protein of unknown function DUF255 [Chloroherpeton thalassium ATCC 35110]
    MSNPKKEPNRLSREKSPYLLQHAYNPVDWFAWGDEAFEKARSEEKPIFLSIGYSTCHWCHVMERESFENEEIARILNEHF
    VSIKVDREEHPDLDKVYMTYVQASTGSGGWPMSVWLTPELKPFFGGTYFPPSDSYGRPGFGSMLLKIAESWQQSRERVLQ
    AAGNISEQLQAFSEMQAEAGAKVPDEAAFQNTFAQFESVFDKDWGGFGNAPKFPRPAILNFLFTFFHQTKNEAALRMALH
    TLRKMADGGMHDHISVPGKGGGGFARYSTDAYWHVPHFEKMLYDNAQLASAYLDAYQITSDRFFADTARDIFNYVLCDMT
    APEGGFYSAEDADSLAAPESPEKTEGAFYVWERAEIDALLGDEASQIFSFIYGVHPGGNASVDPHGEFKGKNILIRRATL
    SQAAQEFGKSEADIAEVMAKSRERLFDARLQRPRPHRDDKILTAWNGLMISAFAKGYMVLDEATYLHAAQKAADFVIEKL
    YNKETGGLLRRYRDGESAIDGKADDYAFFVQALIDLYEASFQFKYLSLALDLAEKQNALFYDAQNGGFFSSTSENKSVIF
    RLKDDQDGAEPSANSVAALNLLRLSQMADREDFRQKAEATVNFFGKILSEAGNQMPQMFAALSFLKQKPKQIILTGAPDS
    PELRALRKAIDSVYEPVKVLLHATEETAGLTSFLSSLSLGSQKPTAYICINYACRLPTSEPAKVREFLVE

    >gi|193215167|ref|YP_001996366.1| thioredoxin [Chloroherpeton thalassium ATCC 35110]
    MAYEISDFQKEVIEHSFKLPVLVDFWAEWCGPCRMLAPTLERLAEKHKGKWALAKVNTDVHQHVAEQYSISSIPAVKLFV
    GGDVVDEFVGALPESQIELWLKKAIPSKNRGQVKAAAQLFEKGKMAEAQKILEPILKEEPDNTEATVVLAQTVLYTNPKK
    AQEIVRNIEADSEFYQQAESIREFGRLFEIAEDIDTLPNGIGKKDYVAAINSLKKHDFDSALQKFVEVIRNDRYYDDDGA
    RKACIAIFKYLGETHDITMKHRKIFNRALY

    >gi|193215180|ref|YP_001996379.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chloroherpeton thalassium ATCC 35110]
    MDLLEVGSEAPLFDTIDQDGNPVRLEALRGQKVVLYFYPKDSTPGCTKEACAFRDRFPEFETLQVVVLGVSVDDEKKHKK
    FAEKYELPFRLLVDTEKKIVQDYKVWGLKKFMGKEYMGTNRVTYLIDENGKIEKVYPKVKPETHAQEILADLQ

    >gi|193215221|ref|YP_001996420.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chloroherpeton thalassium ATCC 35110]
    MAKNNALQKELKNWGIILAVFIFMFVTGLHRPVISALQQLILMTGLMKPDMNLVLEDQPDASYDLELTTLNGEKISLSEF
    EGKVVFMNLWATW
    CPPCVAEMPNIHSLYEKVHSDKIQFVMISLDDSPEKVEAFLERAGYKFPVFMLSGNRPQVYASKTIP
    TTFVISPNGKVATMRQGLASYDTDEFRAFLEKLSKL

    >gi|193215243|ref|YP_001996442.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Chloroherpeton thalassium ATCC 35110]
    MVKKVDVLVIGGSAAGIVAATTGKAFYADKSFLVVRKEKEAVVPCGIPYIFGTLKTVEKNIIPEGHITDAGVELLCDEVT
    SIDKSEKRAETAGGISIAFDKLVIATGSLPKVPGWLKGTGLKNVFTIPKDKAYLAALNEHFDQSEKVVIIGGGFIGVELA
    DELQKRGKAITLIEVMPHILNAAFDEEIGKRAEEILTEKGITLRLGCKVQALIGDEKVKAVQLSNGEEIEADTVILSTGY
    APNVALAEKAGIKINELGSIRVDEYMRTEDKNIFAVGDCAEKFSFYTRIVKGLMLASTACSEARIAGMNLYKLSMLRTFS
    GTMSIFSTAIGGTTFASVGVTEQMAIERGFDIITGAVEGVDKHPKSLPNVSKQFVKLIVSRESGLILGGTVTGGASAGEL
    INVLGVIISNKMTVHHVLSMQVATHPLLTSSPTSYPLIKAAEAVAKKIRDPKPVLH

    >gi|193215362|ref|YP_001996561.1| Peroxiredoxin [Chloroherpeton thalassium ATCC 35110]
    MEAENKSEVMPMPRIGDKAPAFSAVTTQGDIHFPDQYAGSWVILFSHPADFTPVCTSEFMTFATLEEKFAEANCKLVGLS
    VDGLYSHIAWLRTIKEKIEYRGMKNVEVKFPLIEDITMEVAKKYGMIQPGESSTKAVRAVFVIDPKGIIRTIIYYPLSLG
    RNFDELYRVLVALQTADEFSVATPADWQPGDDVIVPTAGSCGVAKERMDGNEEMTCYDWFFCTKKIDKETILKSVLKK

    >gi|193215461|ref|YP_001996660.1| electron transport complex, RnfABCDGE type, E subunit [Chloroherpeton thalassium ATCC 35110]
    MNEAFNVFWRGILKENPVLKMLLGLCPVLAVTTTAINGLGMGLATLFVLLGSNIAVSLFSKIIPSTVRIPAYIVIIATFV
    TIVDLLIKAYSPELNQSLGLFIPLIVVN
    CIILGRAEAFASRNGVVHSILDAFGMGLGFTFALLLLATVREVLGAGTLFNI
    PLAGDEPTPLLVFALPPGAFAGLGLIIAGMNALEKRKAA

    >gi|193215462|ref|YP_001996661.1| electron transport complex, RnfABCDGE type, A subunit [Chloroherpeton thalassium ATCC 35110]
    MKEILIVIVSAIFVNNVVFARFLGICPYIGVSRKLDTALGMGFAVTFVMTLATAISYVLYNGILVPFGIEYMQTVMFILV
    IASLVQIVEIVLKKVSKALYSSLGIFLPLITTN
    CAILGVAILGNQQDYSFFMAVIFAFFSAIGFILAIVIFAGIREKIDT
    ADVPEPFKNVPISFISAAILAMAFMGFSGLVK

    >gi|193215586|ref|YP_001996785.1| 5'-nucleotidase/2' 3'-cyclic phosphodiesterase and related esterase-like protein [Chloroherpeton thalassium ATCC 35110]
    MAVLGMNAFFLTCCIWFVGYFAASSEALGREKEFVVLYTSNTNGYIEACHCSSQNLGGLARRMTLIKQLRKELGHKALLF
    DAGNIFSPYPRGLNREATVAKIVQKMNYDAINLGEQEFTNGLTFLSTKLKTKRLISANVKVKGKNLAAAFYIDRVSGIKV
    AVTGLLTENAYSYLPTAIQAELEFSEPFAALKQALQGINQEKPDVIILMLRALDYQIEKKIAETFPEIHVILTCSEDFSE
    TPSKVYGKTIVSSAGKDGEHVGLLKLHVDMGTQEVSATENRLIDVSPTIPPDPEIDQIIQTANLN

    >gi|193215618|ref|YP_001996817.1| thioredoxin [Chloroherpeton thalassium ATCC 35110]
    MSKYLVATDQNFQSEVLQSDVPVLVDFWAVWCGPCRMIAPVIEELASEYEGKAKIAKLNVDENPQISMAYGIRSIPTLLI
    FKNGEVVDQLVGAVPKNVIAGKLNSQLA

    >gi|193215619|ref|YP_001996818.1| glutaredoxin [Chloroherpeton thalassium ATCC 35110]
    MEKAIVMYSTSWCPDCIRAEWVLKDKNCIYQKIDIELDEQAAQLVMKYANGKRVVPTLVITDGNGHEQILVNPKPQELIS
    AIN

    >gi|193215620|ref|YP_001996819.1| thioredoxin reductase [Chloroherpeton thalassium ATCC 35110]
    MSTDALQQHYKVVIIGSGPAGLTAAIYASRANLQPLVIEGVQPGGQLMTTTDIENFPGFAQGVSGPKMMDEFRAQAKRFG
    AKMIYGEVTGVALSQTPFEVQIDAEKKVFADVLIVASGASAQYLGLASEEKYKGLGVSA
    CATCDGFFFQGKEVFVVGGGD
    SAFEEAIFLTKFATKVTLIHRRSQFRASQIMVNRAESNEKITFLLDSVIEEVIGNGSHVTGVRVKNVIDGNESNMKCDGI
    FIAIGHTPNTKIFEGKLNLDSKGYIITNAKSTATSIPGVFACGDVQDNVYRQAVTAAGTGCMAAIDAERYLENLK

    >gi|193215651|ref|YP_001996850.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chloroherpeton thalassium ATCC 35110]
    MAATPSNMIPLGTHAPDFALIDTVSEKTLSLADVKSGIATVIMFICNHCPYVKHINGELVRLANDYRVKGVSFVAISSND
    VDNYPEDAPKKMKEAAEALGYPFPYLYDESQAVAKAYDAACTPDFYIFDRNLALVYRGQLDDSRPQTEIPVTGKDIRAAL
    DAMLVGKPVSEKQIPSIGCNIKWKKS

    >gi|193215810|ref|YP_001997009.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chloroherpeton thalassium ATCC 35110]
    MFFAEPALSQTVGSDAPDFSATDMNGNKVSLSDLKGKVVLLDFWASWCAPCKMEMPFLIELYETYKEKGFEILAINMDTK
    EKNMKRFIEQVNAKSDRPISFKIVPDPEATIAEKYSPEAMPTTIFIDREGKIRYRYKGFHPSNTDDYKSDLEQLF

    >gi|193215879|ref|YP_001997078.1| dihydrolipoamide dehydrogenase [Chloroherpeton thalassium ATCC 35110]
    MSKESANKTPHEFDFDIAVIGSGPGGYECAIRASQLGYKTCIIEKEQTLGGVCLNWGCIPTKSLLKNAEVIHTLKDAEEF
    GIKLNGFEIDFTKVIRRSRKVATKMAKGVEFLMKKNKIEVKKGYGKLKSAHEIEISYEKDGSSEVVSSQHIILATGTKAR
    SIPSVPVDRERIITSYEAMVLKEKPESLTVIGAGAIGMEFAYFYNAVGTKVTVVELMPQILPNEDEEIATTLAKELKKQG
    IEILTDAQVQKAEAVENGVKTTVKLKDGSEKELQSDYALVAIGLTGNVENLGLEEVGVETERGFIKVDEFGRTNVEGVYA
    IGDVAGGILLAHKASVEGINCVEKIAGLSPEPLDPMSIPACTYCQPSVAHLGMTEKQALEKGYEIKVGKFPFMASGKATA
    SGHNEGMVKLIFDKKYGELLGAHIIGYEATEMIAELGMAKKLEATSEWIHKTVHAHPTFSEAVKEAAAAADGEAINI

    >gi|193215907|ref|YP_001997106.1| Thioredoxin domain [Chloroherpeton thalassium ATCC 35110]
    MEVILYILGGVLAFFIVTPIFIRLKTSFKKGKPVPELPSKYAKAVETGKPTVFYFYSDNCAACKPMTPIIDKYKKKSRNV
    FKIDARKEFSVAQKFGVMGTPSTVLVKDGVIAEFLVGPQPEEKISAFL

    >gi|193215944|ref|YP_001997143.1| protein of unknown function DUF395 YeeE/YedE [Chloroherpeton thalassium ATCC 35110]
    MESTKYMNPYLAGLFLGLLLLATIYITGRGLGASGAIKSLTVATVEAVAPVHAENAPFYKEYNQTHAESPLKNWLVFEVF
    GMVIGAFLSGLVSNRLTLKLEHGPNTTPKVRIVMALLGGALFGFGAQLGRG
    CTSGAALSGMAVLSTGGILTMLAIFGGAY
    VFAYFFRKLWI

    >gi|193215960|ref|YP_001997159.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chloroherpeton thalassium ATCC 35110]
    MVTVGQKFPDFKLEACVSLEHGKEFKHISLEEYLKTGKWLLIFFWPKDFTFVCPTEIKSFNDAYGEFRDRDTELLGASTD
    TAFVHLAWRTHHADLKELKFPMLADAGKKLSGELGILTTEDQVALRATYIIDPEGMVRWVNINDLNVGRNIEETLRVLDA
    LQTDELCPCNWKKGEDVLHV

    >gi|193215961|ref|YP_001997160.1| alkylhydroperoxidase like protein, AhpD family [Chloroherpeton thalassium ATCC 35110]
    MEETRKDLLADLKIEDALYPSLEALVKGEHKYIRDLRINLKNALQSESLGGKKNAYLIALAVAVNEKNRVLAEAFTELAK
    TEGATQSEIAEIHAIASLLASLNVFYRFRHFSSNKSYEDMPAGIKMTIMARPGLGKQFFELVALAVSAVNGCET
    CVNNHE
    KSVRQEGASEQTIFDAIRLASIVKGLTISFQS

    >gi|193216021|ref|YP_001997220.1| electron transport protein SCO1/SenC [Chloroherpeton thalassium ATCC 35110]
    MGKSVLWGIVFLLFVSFVYFFTSQMMGGGGSGQLSIVAKLPEFSLQTADGELFERKDLNEKISVVNFFYTKCPDSCTEQN
    AQIEELQKTFAHMQKVQFLSISIQPEADSVAALKRYSEKFGKAGKTRIWLTGEPEKVKQLIENGFLLSMKNWPEKYSKKF
    VLLDDEARICGFYASGSPEILNILKSHIWELSGKAGE

    >gi|193216205|ref|YP_001997404.1| thioredoxin [Chloroherpeton thalassium ATCC 35110]
    MAEAMPQSFEDLIQTSELPVFVDFWAEWCGPCRMIAPSVKKLAEEMTGKLVVVKVNVDEKPQLAQAHGIMGIPTLIMFHK
    GKEIWRASGALPYDSLKYQVEANLPA

    >gi|193216248|ref|YP_001997447.1| Redoxin domain protein [Chloroherpeton thalassium ATCC 35110]
    MATITFKGNAIHTLGDLPAVGSQAPDFELIKSDLSKASLKDFAGSKVVLNIFPSLDTGVCAASVRRFNLEAANLPGTKVL
    CISRDLPFAQSRFCGAEGIENVVTLSDFATGDFGKAYNLTMTDGPLAHLHSRAVVIVDEDGKVVYTEQVPEIVTEPNYEA
    ALTALK

    >gi|193216307|ref|YP_001997506.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chloroherpeton thalassium ATCC 35110]
    MSGFFESINPINGKFIENLLPRGTKKNVKVGDLAPDFSLPDGNGNSVTLSSFRGKRVLLVFTRIYTDKIICPLCYPHLSS
    LKKDFSKFQELDTEVIVVNTTSAEMTREIVASSAFPFTMLSDEQWKVFELYGLGAAAGAPLPGQFIVGREGKILFVYTCD
    RFPNHPSNEEMFALLKQIAK

    >gi|193216368|ref|YP_001997567.1| peptide methionine sulfoxide reductase [Chloroherpeton thalassium ATCC 35110]
    MVLLFALIFFSCNTESKTNTTNMSDSLSVNESKSGLDTATFGAGCFWCVEAVFQRVNGVLSVVSGYAGGEVEKPTYEQVC
    SGATGHAEVAQITFNPNEVSYEELLEIFWHTHNPTTLNRQGNDEGTQYRSVIFYHSNEQKKIAEASKAKANASGEWREPI
    VTEIVPYTKFFKAESYHQNYYNQHLYQPYCSFVISPKLEKFKSKFSDKLKDVKK

    >gi|193216384|ref|YP_001997583.1| iron-sulfur cluster assembly accessory protein [Chloroherpeton thalassium ATCC 35110]
    MITVTDKAAQQVKRLKTEQNLTDDFGLRVSVKGGGCSGLSYGLDFDNETKNGDQVFEDKGVKVFVDMKSFLYLAGTTLDF
    SDGLNGKGFHFINPNANRTCGCGESFSV