Chloroflexus aurantiacus J 10 fl uid57657

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|163845616|ref|YP_001633660.1| redox-active disulfide protein 2 [Chloroflexus aurantiacus J-10-fl]
    MVSVKVLGPGCANCRKLEERVRHVIRQHQLEAEIEKVTDYAQIMRWNVMRTPGLVVNDVLVAAGRIPSEEEIAGWLR

    >gi|163845628|ref|YP_001633672.1| iron-sulfur cluster assembly accessory protein [Chloroflexus aurantiacus J-10-fl]
    MTTVDLNQITFQPATPQPLLTISEAASSRLLKMMQEKELEGYALRVFVAGGGCSGLQYGMTFDDEVREGDNEFYAGNLRV
    LVDPISAQYLFGASIDFVDTLMGGGFKIDNPNAVSSCGCGHSFRARDTDYSEDDEDAPVGGCSACGM

    >gi|163845664|ref|YP_001633708.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chloroflexus aurantiacus J-10-fl]
    MSRPFIPMTAKWRQEFIKPRGPANVPAVGSEAPDFTLPYAQFLSGPPEDRVEYGRTITLSALRGRPVVLNLTRIVSDRFF
    CPHCAPQLDALREHYDLFVQRNAHLLVVSSTDLEMTSYVAEVLRAPYPILSDPEWGVFYRYGMGSAMGVPLPGVFVIDAD
    GIIRWSWAAPLSVVFTPPRPAELAAVLDALASEG

    >gi|163845803|ref|YP_001633847.1| thioredoxin domain-containing protein [Chloroflexus aurantiacus J-10-fl]
    MITGVSNKANPATAQAVVIDVTEATFEREVLQRSQQTPVVIDFWAPWCGPCRVLGPTLERLAREAGGTWVLAKINVDENP
    RLAQMFRVQGIPAVKAVYQGKIVDEFTGALPESQVRTWLKRIVPDRNADLLAMAQALEATNPVEAIARYRLILGQDPNNE
    AALFHLGRLLALRGDPEGITTLKQVPAGGPFGGRAIAGLAIADLVNAPAEPADGSEGLYRQAAIAVRSGDYATAIEHLLT
    LVARDRAFRDDGARKALLALFALLGDDHPLVGPARRRLANLLF

    >gi|163845826|ref|YP_001633870.1| rhodanese domain-containing protein [Chloroflexus aurantiacus J-10-fl]
    MFRQLFRRDVVQNHIATMTVQELKTQLDARAPMVLIDVRQPEEFAYDGHVSGARLLPLPVLASRLNELPKDQPIVCICRS
    GNRSQVACEMLQRHGFTNVTNVVGGMVAWQRAGYPVSRQH

    >gi|163845829|ref|YP_001633873.1| rhodanese domain-containing protein [Chloroflexus aurantiacus J-10-fl]
    MKYRFLLLLMIGLALLTACGTTTASTSTTSTPANITVARLKSMLDQNETFFLLDVRTPAEFVQDGRIAQATLIPLQELEQ
    RLSELPTDKTIVCI
    CRSGNRSSVACNLLKERGYQAINVTGGMNEWKAAGYPTVFGQ

    >gi|163845898|ref|YP_001633942.1| DSBA oxidoreductase [Chloroflexus aurantiacus J-10-fl]
    MRVRLLVLIMLLSLTACTAATPVPSPTAIPRLPTVTPEPLSQSTPTPRIIRLSESPLPVFTPTPIPTPVISADGITTASM
    AQLGISAEPYAILGDPNAPVTIIEFTDFG
    CTFCRRHHVLTFPALREEFISSGQVFYVVRQLPVTSPHGDQAALAALCAGE
    QGKYWEMHDQLFAAGDAWYSDATTARRRIIALATDLGLDSAVLQRCMEHPATQATLARHVSEAHALRVFGTPTFFINNQL
    FAGAQPIARWRDVLEGGGRR

    >gi|163846157|ref|YP_001634201.1| electron transport protein SCO1/SenC [Chloroflexus aurantiacus J-10-fl]
    MKHLITLILAVLSALLLSGCGAYEFRGTVLEPPNPAPEIPLVDQFGNEFRLSNYRDKIVLVFFGFTHCPDICPTALGDLK
    RVMEKLGNDAAKVQVVFVSVDPERDTPDLMQRYLAAFNPTFLGLNGDRAVLEQVYKSYGVTVIKRELPNSGLGYTIDHSG
    YIYAIDQAGNWRLLWAHGTPVDDIVSDVQALLRNPPRG

    >gi|163846168|ref|YP_001634212.1| copper-translocating P-type ATPase [Chloroflexus aurantiacus J-10-fl]
    MAEREVILPITGMTCASCSARVEKALRKAPGVLAAEVNLAGEQALVRYDPGLVQPEALQAAVEQAGYGVVVDEITLAITG
    MT
    CASCSARVEKALRKLPGVLAAEVNLASEQALVRYVPGMVERTDLVAAVEQAGYGVILPSATDEAAEDVEARAREAEMT
    VRRRRLLVGVVFGLPLFVLSMARDFGLIAPWLIGEGAAMMATMRDAAMGEIMAMVAARDDLLNWLFLALATPVQFYSGRD
    FYRHAWRALRARTATMDTLIALGSSAAYFYSLAMLLSGAPGHVYFETAALIITLILVGKYLEARAKGQTSAAIKALIGLQ
    PKTARVVRGGQEVDVPLTEVRVGEMIIVRPGEKIPVDGVIVSGESTIDESMLTGESLPVEKRSGDPVFGATINRSGSFQM
    RATRIGKDSALAQIIRLVQEAQGSKAPVQALVDRVSAVFVPIVIVIALITFLGWLWAGVGLTQALIFAVAVLVIACPCAL
    GLATPTAIMVGTGTGASHGILIRNAEALERAASLHAVVFDKTGTITHGRPAVTDVVMVARPVLAQGTQSDGTGDQVLLQI
    AAAAESRSEHPLGVAIVKAAQERGLAVERPTRFQAVSGAGVEAEVGGQTVLVGTLRWLRERGVEIHALEAIVDQLQNEGK
    TAIAVAVDSEAWGVIALADTVKPTAAEAVAKLHQAGIEVALLTGDNQRTAAAIAAAVGIPATAVYAEVKPDEKAAIVARL
    QQSGPHGKPRRVAMVGDGINDAPALAQADVGIAMGSGTDVAMETADITLMRSDPRGVVQAIALSRATVRTIRWNLFWAFA
    YNVLLIPVAAGVFYPLTGWQLSPVLAAAAMAFSSVFVVTNSLRLRRVRMG

    >gi|163846169|ref|YP_001634213.1| heavy metal transport/detoxification protein [Chloroflexus aurantiacus J-10-fl]
    MVTEQFRVPGVSCQHCVHAVRKEVSALQGVSQVEVDLSSKIVTVVHDDAVDITDIVSAIKEAGYEDVTPLGTAC

    >gi|163846396|ref|YP_001634440.1| electron transport protein SCO1/SenC [Chloroflexus aurantiacus J-10-fl]
    MRRFLFICWIVMICTACSAVSPPGTTTATIIDPPTVLSDFQLPASTGHDLRLSDLRGQPVLLYFGYTRCPDYCPITLSEF
    RRTREQLGADGEKVHFVLISVDPAHDTPEVLAAYLRGFGEGFIGLQGDDATLRRISKEYGLTYRHGGGHQQHGDAGVEHS
    TASYLIDQNGRLRIVYQYGTAANVYVQDIRDLLKEAQ

    >gi|163846446|ref|YP_001634490.1| heavy metal translocating P-type ATPase [Chloroflexus aurantiacus J-10-fl]
    MNKQQFTISGMDCPDCARKIERGVARLPGVTTCELHFTTARLHVAGDVDPATVIARVRDLGYDIQAEASSGDELPPTFLR
    FMLSRRETQLALIGLVLVLPGIVLHEVLGWDALWIEVLSLLALALVGPGIARQAWRTLRTNRELGIDALMTIAAIGAVVI
    GAYVEAGLVLVLYAIGEALEGYTANRARHAIRSLLELTPPTATRLTSGGEQVVPVADLQVGDRILIRPGERIPVDGTIVA
    GSSLVNQAPITGESRLVERDVGDTLFAGTMNGEGSIELRVDRPAAESAVARMIHLVQEAQERRAPVQRFIDRFARIYTPL
    VTALAALVAIVPPLVFGQPFWNPDPDTFGWLYRGLALLVVACPCALVISTPVSIVSALSTAARYGVLIKGGAYLETLARV
    QTIALDKTGTLTTGKPTVVGLRAVGCPAGEATPVGHCRTCDELLTIAGAVERRSEHPLAHAIVGAAVNRGLTLPPAEQVR
    ALTGKGVVGVVNGDEVLIGSHRVFDQALRHDEWHCLAAKHDSQLGYTPLMVGVGGQYRGTITVADTVRAESRSAVAALRD
    QGLRIVMLTGDEPATAERIAGEIGVSEVRAGLLPETKAQVVSALRQSGGVVAMVGDGINDAPALATADVGIAMGVQAGGT
    TQAMETADITLLGGDLRQLPFAVALSRQTMRTITANIVFSIGIKLIFIVLVLAGLSTMWMAVLADVGASLLVTLNGMRLL
    GFRARLPQ

    >gi|163846513|ref|YP_001634557.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chloroflexus aurantiacus J-10-fl]
    MSNMNRPNYYSLLGITPDADQAAIDAAYAEQRQRYAPERVADLDDELRAVAQERLQTIERAYHVLRDPERRRQYDISQGL
    IPSTSRPVRRELSRREWLSVFAFSFIAVAVVAGVWIFTNRETLTGQAMGEVNRPAPDFTAPELRGGTIELSQYRGKVVVL
    NFWGTW
    CEPCKRELPALQQAYEQFSDQGLMVIGVNLTDDEQVNGQTIADVAAFLAQYGVTYPIALDTEGTITEAYRVFPL
    PTSFFITPDGQIRYVHIGELTLDDITARFTELRAASGGQTSQ

    >gi|163846817|ref|YP_001634861.1| hypothetical protein Caur_1244 [Chloroflexus aurantiacus J-10-fl]
    MNAGSRPLNRLAHEASPYLQQHADNPVDWYPWGEEALERARREDKPILVSIGYAACHWCHVMAHESFADPEVAAVQNEYF
    INIKVDREERPDLDNIYMAAAQALTGRGGWPLNVFCLPDGTPFFAGTYFPPDAKAARYRMPGWRQVLLSVAEAYKTRRAD
    VTASAHELLEHIKLLTRPLPETLPLDEELLMAAAAQIGREFDPQYGGFGDAPKFPQPVVLEFLLRTHLRGDVQALPMLQQ
    TLEQMARGGMYDQVGGGFHRYSVDERWLVPHFEKMLYDNALLAEVYHLAAQVTGDTFLARIADETFTYMLRDLRHPDGAF
    FSSEDADSLPTPGASHAEEGAFYVWTPDELRAALGDDAVLVGAYYGVTRQGNFEGRSILHVPRPAAAVAAMLGVSVERLE
    ATVARARPILRTFRERRPRPFRDEKVITAWNAMAIRALAVASSRVPAYLDAARQCADFLLTNLRRDDGRLLRSWKDGRPG
    PAAFLDDYALFCDALIELHAAGGDTRYLATAIDLADAMIDLFWDDQAGMFFDTGRDQPALVTRPRDLSDNATPSGSSAAT
    VALLRLYAITGRERYETRAMQTLQQTTPLLKRFPLGFGRMLCAADLALGPLRELAIIGPPDHPVTQAMLAVARSAYRPRL
    VIARAMPDDPVVTLSPLLNDRPMVDGQPTAYLCEQFACQMPVTTPEALQAQLG

    >gi|163846980|ref|YP_001635024.1| methylated-DNA--protein-cysteine methyltransferase [Chloroflexus aurantiacus J-10-fl]
    MPNHDSQARDDKRAARVRPIREVAYADSPLGRVLVAATDSGLCAVYLGDDDAALLATLHASFPVAGTAAGVLAETAASAI
    AAYLRNEAPLPAFPLDPIGTPFQQLVWQALCTIPRGSTRTYGQLAQELGLPTGAARAVGRACASNSLAIVVP
    CHRALGSD
    GRLHGFRWGIERKRALLALEGVFLPLL

    >gi|163847224|ref|YP_001635268.1| peptide methionine sulfoxide reductase [Chloroflexus aurantiacus J-10-fl]
    MPLETATLAGGCFWCLEAVYDQVSGVKDVVSGYTGGYVPNPTYRRVCDGNTGHAEAVQIQFDPEQISYRELLEIFFSIHD
    PTTLNRQGADVGTQYRSAIFYHSEEQRQVAEQLVRELTEQQVFRDPIVTQIVPATTFYPAEEYHQEYFARNPYQPYCQFV
    VAPKVAKFQKLFAHRVAGEKS

    >gi|163847252|ref|YP_001635296.1| uncharacterized peroxidase-related enzyme [Chloroflexus aurantiacus J-10-fl]
    MDHSERPISRFPYPERLDDLPVDIRERIEKVAEKSGFIPNVFLALAQRPDEFRAFFAYHDALMERPSNLSKAEKEMIVVA
    TSAANDCLY
    CVIAHGAILRIRSKNPRLAEQVATNYRRAEITPRQCAILDYALKVALDSARISEEDWQPLMAHGLTLDDIW
    EIGAIAAFFAMSNRLANMSALRPNDEFYTMGR

    >gi|163847382|ref|YP_001635426.1| OsmC family protein [Chloroflexus aurantiacus J-10-fl]
    MGTVIHASVRLREGLHFTAVADSGRAIELDSPHEGNTDLAGPSPMETVLMALAGCSAMDVISILRKKRQPVTGLEVKAQG
    VRGDEYPKPYTNIELVYRCSGEVDPAALERAIELSRERYCPVWRMLGATVDIQYRYEIVPALD

    >gi|163847384|ref|YP_001635428.1| glutaredoxin-like protein [Chloroflexus aurantiacus J-10-fl]
    MTTQSIVVYGTNWCPDCRRAQRVLDQHGVPYTYINIEHDPAAAEFVIKVNNGNQSVPTIVFPDGSILVEPSNHLLQTKLN
    QLG

    >gi|163847535|ref|YP_001635579.1| rhodanese domain-containing protein [Chloroflexus aurantiacus J-10-fl]
    MSLELPSGPLVETDWLAAHLGHPKLRIVDMRGTVLPPSAPKPHYFARHDDYAAGHIPGAVYIDWTRDIVDLDDPTPVQVA
    PPAKIAEELGKRGIGDDCVVVAYDDWYSMFAGRLMWVLRYYGFEQVRVLNGGMVKWVAEGRPLTTEVPDYPPAIFTPRPQ
    PHLRKTADQVLQALGSDLLLIDARHEREYQGFESRAARGGHIPGARNVFYQSLVSGPHQTYLSPDQLRERFLAAGIDPDA
    TTDREVVAY
    CNGGVSATPTAIAFELVSGRRVAIYDGSWNEWGNDPTKPLERAEASSGE

    >gi|163847563|ref|YP_001635607.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chloroflexus aurantiacus J-10-fl]
    MATPPQVGEMAPDFTLPNEAGEPVSLSQFRGKRVILYFYPKDDTPGCTSQACGFRDSYPVIEEKNAVVIGISPDGTKSHA
    KFKTKHNLPFILLADEQHSVAEAYGVWGEKSMMGKKYMGIIRSHFVIDEEGRIVQAEIKVSPADSVKRALAALGL

    >gi|163847623|ref|YP_001635667.1| thioredoxin reductase [Chloroflexus aurantiacus J-10-fl]
    MHHKVVIIGSGPAGLTAALYAARANLEPLVIRGLQPGGLIATTSEVENYPGFVDGIGGFELAEAMEKQAARFGAQFLDSL
    VTKVEVAQRPFTIHTDSGQTVTADAIIVSTGASPRKLGVPGEEELANRGVSY
    CATCDGFFFRGKKVVVVGGGNSALDEGL
    FLTRYVDELVIVHRRDTLRADPILQERAFSNPKVRFIWNSVVVSINGKDKVESVTLRNLQTGEVSELPTDGVFPYIGHVP
    NTDLFRGILELDEGGYIVTDGRTRTNIPGIFAAGDVTDHIYRQAVTAAGDGCRAAMEATWYLAEQEHARSKATVSVA

    >gi|163847637|ref|YP_001635681.1| pyruvate flavodoxin/ferredoxin oxidoreductase domain-containing protein [Chloroflexus aurantiacus J-10-fl]
    MGSRRITLDGNEAVANVAYQLSEVIAIYPITPSTPMGEQADAFAATGKPNLWGVVPTVYEMQSEGGAAGALHGAMQTGAL
    TTTFTASQGLLLMIPNLFKMAAEMTPGVFHVAARAIATQGLSIFGDHSDVMAARATGVGMLASASVQEAHDLALIAHASS
    LAGKLPVIHFFDGFRTSHEVNTIIALEDDEIRAMIKDEWVHDQRAHALSPEHPVIRGTAQNPDVAFQARERIQPILDAFP
    AVVQAQMDRFASITGRQYHLFDYFGAPDAERVIVVMGSGGETARETAFYLNQQGEKVGVVQVRLFRPFAEAAFRAVLPPT
    VRAIAVLDRTKEPGAAGEPLFLDVVAALRGQPITIIGGRYGLSSKEFTPGMAAAVFAELNKPQPKAHFTVGIIDDVSNSS
    LEYDPDLCIDPPGTVRCVFWGLGSDGTVGANKNSIKIIGDSSEGDAERYAQGYFVYDSKKSGSVTISHLRFGPSPLATPY
    LIGKGQAQFVACHQFSFLERFDVLQYAAPGGVFLLNSPYGPDQVWHQLPSVVQRKIRDLKLRFYVIDATAVANEVGMRGR
    INTVMQTCFFAISGVLPRDEAIAAIKQAIKKTYGRRGDTVVRQNWAAVDRTLDRLYEVPIPPPTEDNGLAMRPPVPANAP
    AFVRDVLGAMIAGRGDELPVSAIPIDGSFPTGTTKWEKRNIALEIPVWDPNI
    CIQCNKCVFVCPHATIRAKVYPEEALAG
    APEGFLSAPARFKEFPGQRYTLQVAPEDCTGCGLCVEACPVKDKRAVGRKAINLQPQAPIRAREATYWDFFLSLPDVDRT
    QIPMGSVKHTQLFVPLMEFSGACAGCGETPYLKLLSQLFGDRAIIANATGCSSIYGGNLPTTPWTTNAEGRGPAWCNSLF
    EDNGEFGLGMRLSIDQQLAHAQMLLQRLRPLLGAEFVEDLLNADQRTEAGIREQRERVAILKQRLTELLQDNPPEAPQMR
    DLLALADVLIRRSIWIVGGDGWAYDIGFGGLDHVFASGRDVNILVLDTEVYSNTGGQASKSTPTGAVAKFAASGKGGVKK
    DLAQIAMTYGDVYVARVAFGADDVQTLRAFQEAEAYPGVSLIIAYSHCIAHGYDLRRGLEQQRLAVESGIWPLYRYNPAI
    HEGSPLTIDSKAPTIDPEVYLRGEGRFQMLQQANPARYEQLLASLRRQVALKWAHLQWMANELLAETKEGLR

    >gi|163848050|ref|YP_001636094.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chloroflexus aurantiacus J-10-fl]
    MMNAQSHNWLSTILIIVGVAWIVISRPPDMNPTVPVPQPGFVAPAIVLPQLDGQTLSLSELQGQVVIVNFWASWCGPCRA
    EMPMLEQLYQAERRRGLTVLAVNSTVQDNPADVSNMQRDFGLSFPIVLDYDGSVGNRYGVRMLPTTFIIDRKGVVRRVLF
    GGPLSEANLRNVIEPLLAETE

    >gi|163848092|ref|YP_001636136.1| thioredoxin [Chloroflexus aurantiacus J-10-fl]
    MAKPIEVHDSDFAEKVLKSKTPVVVDFWAPWCGPCRVIAPILDKLAGEYAGRLTIAKVNTDDNVQYASQLGIQGIPTLVI
    FKDGREVGRLVGARPEAMYREIFDKVLAMA

    >gi|163848168|ref|YP_001636212.1| hypothetical protein Caur_2617 [Chloroflexus aurantiacus J-10-fl]
    MLVERLLIIGVVTLAVLLVWAGVRYWQARTVRSLAQKSPFVGLVPTGKPAVVAFTTPGCRECHFRQAPALARLAGAVNDQ
    VTQVTICTLQAADYPQLVTQLGILTAPATVVLDARGVVRHINLGFVDTPVLLQQVGLLTREVGIRQTTVAG

    >gi|163848334|ref|YP_001636378.1| glutathione peroxidase [Chloroflexus aurantiacus J-10-fl]
    MNIYQFTVRTIDGEQQSLAVYRNKVLLIVNVASHCGLTPQYGDLESLYRRYKDRGFVVLGFPSNQFNQEPDDEATIKSFC
    ARTYAVTFPLFAKVEVNGPNTHPLFAYLKAQQPGLSPDGEIKWNFTKFLVNRNGTVVRRYAPTDTVGAIERELVELL

    >gi|163848386|ref|YP_001636430.1| dihydrolipoamide dehydrogenase [Chloroflexus aurantiacus J-10-fl]
    MSEQVYDLVVLGSGPGGYVAAIRAAQLGMKTAIVEVNALGGVCLNIGCIPTKALLHSADLLEEVKEAKRFGITVENVAFE
    LAGAMKHKDTVVKQSTDGVAFLMKKNKIEVVAGRGRLIGRGQVHVQLNEGGERVLAAKHIIVATGGRPRPFPGIPFDGER
    VLSSTDMLTLKTVPSSLLAIGAGAIGVEFASMFRSFGSDVTIVEALPRIVPNEDEEVSAELTKAFQRRGIKTLAGAKVEG
    VDVGGEKVVVTVVDSSGKPQQIAVEKLLVSIGIAPNTENIGLEEVGVKVNNRGFIETDGFLRTSAEGVYAIGDCTANTPW
    LAHKASAEGILAAEHIAGHHVTPIDYGKIAACTYCNPEIASVGLTEAKARERGYQVKVGKFPFSANGKARVLGQTRFGFI
    KLVADAQYDEILGVHMIGPRVTEMIAEGGIALSHEATGESMMQTIHAHPTLYEAIGEAAHALVHGAPIHL

    >gi|163848572|ref|YP_001636616.1| DSBA oxidoreductase [Chloroflexus aurantiacus J-10-fl]
    MSVQSTRGRRVKTAKQNNLLYLYIAVGVVAVIAITGLVVLLTRNNTEVKAPTAPVGRTEEGFYYKGDPNAAVKVIAFEDY
    Q
    CPGCAYFSRNLAPILERDYINTGRVQFIYHELPLTNIHPNAVAAAEAARCAGDQGKYWEMHDQLFANQSLWAQLSSPLN
    VFSGYAGRIGIDRAAFDACMQAGTHREAILAAAQEAAALGVQATPSFSVNGQIVDSGRLFTAIDAALRAAGR

    >gi|163848672|ref|YP_001636716.1| periplasmic binding protein [Chloroflexus aurantiacus J-10-fl]
    MRIVSLLPGTTEIVCALGLADHLVAVTHECDYPPEVKGLPVVTRSLLDETETASSSEIDTAVRERARNELSIYELDMELL
    SSLQPDIILTQALCDV
    CAVPLHQVEASLANPAIQVLSFEPVDLAGIFGSIKAIGRALGVAERAEHLVNELTARVERVKTL
    AAQATSRPRVVCIEWLDPVFGPGHWVPEMVAIAGGQPLLGTAGGHSRRIIWTDVIASAPEVLIVMPCGFTLERTIAEARA
    ILPQRAGWDALPAVRMGRVFAVDGNAYFSRPGPRIVDSLELLASMIHPELFAGWGPTGASAVIQ

    >gi|163848707|ref|YP_001636751.1| DSBA oxidoreductase [Chloroflexus aurantiacus J-10-fl]
    MKYVPVYYLHDKIMRFSLLLILVFVVTGCGSAVPPVPTRSAVELRQTQVALQGLPTVPPAPTELSRPTPTPAPPVDLVEL
    LKLTDDDPRAMGDPNAPVLMIEFTDYE
    CPFCARFVSESRPRIVREFVETGVVRLVVRDFPLTSIHPSALLAAGVAHCAAA
    QGQFWPVYEMLFQTHNVEWGGVPNRDRDVLIELAGKLGVDTAQLRACLDDPATEATIIAEVETATRLGINSTPNFIINGR
    IVRGAFPFESFASLIRRLAELP

    >gi|163848760|ref|YP_001636804.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chloroflexus aurantiacus J-10-fl]
    MKPTCHGKRGTMKPKSIRTIDLTKRTMKRLIILLSLILVACGTTTPPSQALLVGDTPIAAESRLIDTRPDWAAIPGEMAP
    DFSYTLADGTYKLSDLRGKPVIVNFWATW
    CLPCVEEMPTLDAARRTNPDLVILAVNRNESTEAISAFAPKVGVSFPLITD
    RDGVIGERYGVINLPTTFFINSDGTIAVRHVGALTAERLAERLAEVR

    >gi|163848873|ref|YP_001636917.1| OsmC family protein [Chloroflexus aurantiacus J-10-fl]
    MAPIWSLREFLARKREALSAFRSRLRDQPPSPVTLRAAVTVAAGTGLRPVRVRDHTVISDSGPALGGYDLGPNAPELLLA
    AMAS
    CIAHSALAIAADRELAIDDLQVEVSGQIDYRGALSVSADAPVAPTGLHYTLKYRGEVTDAEMTALQADLERLCPVL
    LAVLQPQPLSGQVQRLEA

    >gi|163849016|ref|YP_001637060.1| rhodanese domain-containing protein [Chloroflexus aurantiacus J-10-fl]
    MSGYAHPEALVETQWVADHLNDPNVRIVESDEDLLLYDTGHIPGAVKIDWVQDLNDPVVRDYLDSDRFAALMRVKGISND
    TTVVLYGDKHNWWATYAFWVFKLFGHRDVRIMNGGRAKWIAEGRPLTREVPSYPPGNYVAPPRNDAEIRAFRDQVLEFVR
    QRKGVLVDVRSPQEYTGERTHMPDYPQEGTLRGGHIPTAVNIPWARAVNEDSTFKSVEELRELYAAQGVTPDKEVIAY
    CR
    IGERSSHTWFVLTYLLGFPNVRNYDGSWTEWGNSVGLPIEKNV

    >gi|163849021|ref|YP_001637065.1| UBA/THIF-type NAD/FAD binding protein [Chloroflexus aurantiacus J-10-fl]
    MSEVTLSNEEIARYSRHLIMPEVGMAGQRRLKQGSVLLIGTGGLGSPLALYLAAAGVGHIGLVDFDVVDASNLQRQIVHG
    TSTVGVAKTESAKRRLQDLNPYIEITTYETQITSQNALDLMRPYDVIVDGTDNFPTRYLTNDACVLLGKPNVYGSIFRFE
    GQATVFSARDGGPCYRCLYPEPPPPGLVPS
    CAEGGVLGVLPGVIGTIQATEVIKLLTGIGEPLIGRLLLYDALSMRFREL
    KLRRNPSCPVCGDHPTITELIDYEQFCGIAPEEPTLSNQFEITPRELAEWLERPDRPFLLDVRNPYEVAIASIPGTDKLI
    PLDQLPERINELDSAREMVVY
    CRSGVRSGRAVELLKTAGFRKVKNLVGGILRWADDVDPSLPKY

    >gi|163849093|ref|YP_001637137.1| redoxin domain-containing protein [Chloroflexus aurantiacus J-10-fl]
    MTIERPDAFVFFGPQTVVGPELKPGDKAPDFTLINSKMQQVTLGDFAGKPLLISVVPSLDTGVCSKQTTRFNEEAARLAG
    QANFITVSADLPFAQARWCGANNADAIQTLSDHRDMSFGTAYGTYVPAYRIEQRAVFVVDRDGVIRYSEYVPVAGQEPNY
    DAALEVLKSLL

    >gi|163849109|ref|YP_001637153.1| beta-lactamase domain-containing protein [Chloroflexus aurantiacus J-10-fl]
    MTTLNYPPSGLSVLEPAELYAELLAGQPLFILDVRNELEYARNRIRGRYPVPTLNIPYFAFIEDEESAVAQVPTDQLLTV
    I
    CAKEGSSQYVAELLAARGIATRYLRGGFQAWLDFYDVRDVVNAGWGRIIQIIRPARGDLSYVIISAGEAAVVDPGRHIH
    LYQEVAAAADADITRVLLTHLAAGRLSGGAALAGERKALLAMHPYDALHPRTLSPAHLTYVPLLGGERVALGQLLIEAHW
    FPGHTPGHLVYRVISPMGDRFLLTGDALLLNGCGRTDLGGHAQEWTALLFRSLQEVLPTLVDDRTLILPSSFLSLAETRS
    DGVVAAPFAALRAQHPALQVDSAASLLPMVTTPSSELPAAVDTFWRVNLGLQPLTDEEALELEVEPSLCGLSGY

    >gi|163849113|ref|YP_001637157.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Chloroflexus aurantiacus J-10-fl]
    MGRRVVVIGGGAAGMSAAAKARRTDPTLEIVVYERSGFVSYGACGFPYAIKGEIARVEDLIVRTPEQFARQGIQALVRHE
    VLEIDPDRQTVRVRDLRSEREFVDHWDDLVVTTGGQPGRPPLPGIDLAGVFALRQVEDALAIKEWLNEQRPRSGVIIGGG
    YIGLEMAEALAAHGISLTLIERLPQVLPAMDADLASQIEAELIRQGVDLRLNQTVQGLVGDERVRAVIAEGQTIPAEIVI
    LAVGVKPGVALAQAAGIGLGPTGAIAVDDHQRTNLPQVWAAGDVAEAWHRVIQKPVWMPLGTTANKQGRVAGENLAGGDA
    RFGGIVGTVAVKVFALEAAMSGLSLARAQAEGFAAEAVQATAGSRAHYMPGHQPITVSLVFDRNTRRLLGGQMVGREGVA
    KRIDTIAAALQAGWTIDDLAELDLSYAPPFAPVWDPILVAANLARK

    >gi|163849211|ref|YP_001637255.1| glutathione peroxidase [Chloroflexus aurantiacus J-10-fl]
    MTIYQFSAQRIDGSTQSLADFRGQVLLIVNVASMCGLAPQYAGLEQLYRRYRDQGFTVLGFPSNQFMQEPRNNEAIAEFC
    ERTYQVTFPLFAKIDVNGPNEHPLFTYLKTQLPGLFGSTAIKWNFTKFLVDRNGKPYRRYAPTDLPSQIEDDIVLLLRQQ
    PKSLSA

    >gi|163849418|ref|YP_001637462.1| beta-lactamase domain-containing protein [Chloroflexus aurantiacus J-10-fl]
    MLLKYFYDEMLAQASYLIGCAKTGEAMVIDPMRDVEPYLRVAAKEGLRITHVTETHIHADFVSGVRELAARTGAQMYLSD
    MGDANWKYAYPEIEKAILVKDGDTWMVGNIKVQVIATPGHTPEHIAFMITDTAGADQPMGVFTGDFLFVGDVGRPDLLEE
    AAGISGTKEPGARKQFQSVRRFAELPDYLQVWPAHGAGSACGKALGAIPSSTLGYEKRFNPAFQFDDEDAFVRWLLKGQP
    EPPRYFARMKYVNKVGPALLHDLATPVEVERPLLDQAMAEGAMVFDLRSAAEFVAGHVPGSISVPIRKMYSTYVGWFVDF
    NKPTYLVVPDGADMNQILKDLRAIGVDDIPGYLPASALGDNLVQLPTATVKDLSAALSDHSAVILDMRNLTEYEEIHLPG
    ALHIPLGYLPRRLDDIPRDTPIIAH
    CATGYRSQVGTSLLRRFGFTNVATLVDPQGTWRELASAVAV

    >gi|163849422|ref|YP_001637466.1| glutaredoxin-like domain-containing protein [Chloroflexus aurantiacus J-10-fl]
    MALMQEKDRKAVQGAFTGLNRPVDIVLFTSAESGEYSEVTQELLQEVVALHPMLSLHVYDLDQDSAYAAELGVDKAPGIV
    FLVGEERQNHGLRFAGLPSGYEFASLIEAIRLAGGAVQPDLQPATMALLETIQSPMHLQVFVTPT
    CPYCPRAVVMAYRLA
    LASPYISAEGIEVTEFPELGDRYAVMGVPKTVIDDLVHIEGAVPEGMMVNKLREAIAAAA

    >gi|163847385|ref|YP_001635429.1| DSBA oxidoreductase [Chloroflexus aurantiacus J-10-fl]
    MVNTSGSYCSMVRRLILSFIVLLTACSAPAAMSPTATPSPVPTRAPTSTPTTADSTPVVAGYFPDLPRGRTPEGYHYLGR
    PDAPVTMVIYSDFL
    CTSCAIHTLDVEPRLIEAFVATGQMRLVYRHLLQLGERSQILAEASECASDFGYFWELRREIYARY
    NQLYFNTRETVIDLAAGLGIPRDAFTTCLDSHTYQAQVQADYAAAIEEGVYARPVFRIGTEVIVGSQRFETFAQVIERVG
    QW