Chloroflexus aggregans DSM 9485 uid58621

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|219847003|ref|YP_002461436.1| beta-lactamase domain protein [Chloroflexus aggregans DSM 9485]
    MLLKYFYDEMLAQASYLIGCAKTGEAMVIDPMRDVEPYLRVAAKEGLRITHVTETHIHADFVSGVRELAARTGAQMYLSD
    MGDANWKYVYPEIDKAILVKDGDTWMVGNIKVQVIATPGHTPEHIAFMITDTAGADQPMGIFTGDFLFVGDVGRPDLLEE
    AAGIAGTKEPGARRQFQSVQRIKALPDYLQVWPAHGSGSACGKALGAIPSSTLGYEKRFNPAFQFDDEDAFVKWLLHGQP
    EPPRYFARMKHVNKVGPALLHDLATPVEVERPVLDQALAEGATVFDLRSAAEFVAGHVPGSISVPIRKMYSTYVGWFVDF
    NKPTYLVVPDDADLQQILKDLRAIGVDDIPGYIPASALGGNLAQLPTATVKDLSEALANQSAVILDMRNQTEFDEIHLPG
    ALHIPVGYLPRRLADIPRDTPIIAH
    CATGYRSQVGTSVLHRLGFTNVATLVDPQGTWRELVSAVTV

    >gi|219847007|ref|YP_002461440.1| glutaredoxin-like domain protein [Chloroflexus aggregans DSM 9485]
    MALMQEKDRQAVREAFRGLQHPVELVLFTSADSGEYSEVTQELLQEVVELNPLLRLNVYDLEKDGAYAAELGVDKAPGIV
    FLSGEERKDNGIRFAGLPSGYEFASLIEAIRLAGGATQPDLQPATLSLLETIKAPMHLQVFVTPT
    CPYCPRAVVMAYRLA
    LANPYITAEGIEVTEFPELGDRYAVMGVPKTVIDDLVHIEGAVPEGMMVNKLREAIAAAA

    >gi|219847151|ref|YP_002461584.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Chloroflexus aggregans DSM 9485]
    MTAQRVIVIGGGAAGMSAAAKAKRTNPTIDIVVYERSGYVSYGACGFPYAIKGEIARVEDVVVRTPAQFAQQGIQALIHH
    EVLAIDTARQRVLVRDLHTGREFTDHWDELVVTTGGQPARPPLPGLDLPGVFGLRSVEEAIAIKTWIGEQRPQAGVIIGG
    GYIGLEMAEALDAHGIALTLIERLPHVLPAFDPEMAAQVEEELRRQRVDVRLGQAVQAIVGDERVRGVIVDGQTIPAEIV
    ILAAGVKPNVGLVRETGIALGPTGAIAVDDHQRTNVPRVWAAGDVAEVYHRVTGKPAWIPLGTTANKQGRVAGENLAGGN
    ARFGGVVGTTVVKVFEREVAISGLSLTRAKAEGFDAVSVSATASSRAHYMPGHQPLTVTLVFDRATRRLLGGQLIGREGV
    AKRVDTVAAALQAGWTIDEFAELDLSYAPPFAPVWDPLLVAANLARR

    >gi|219847260|ref|YP_002461693.1| periplasmic binding protein [Chloroflexus aggregans DSM 9485]
    MRIVSLLPSTTEIVCALGLEDQLVGVTHECDYPPTVRGLPVVTRSVLDLPETVSSAEIDTAVRERARNDLSIYQLDMALL
    HALQPDVILTQALCEV
    CAVPLRQVESVMAGGTAHILSFEPTSLAGIFGSIKAIGRALGVPERADALVQALNERVERVRAQ
    TARISHRPRVACLEWLDPVFGPGHWNPELVTIAGGHPVLGVAGERAQRVAWPDVIVCAPEVIVVMPCGFTLERAVAEAQA
    LLPQRTGWYALPAVRNGRVFVVDGNAYFSRPGPRIVDSLELLAALIHPDVFAGWSLPNAAVVLR

    >gi|219847273|ref|YP_002461706.1| Glutathione peroxidase [Chloroflexus aggregans DSM 9485]
    MSVYQFTAQRIDGTLQPLSEYRGQVLLIVNVASMCGLSPQYAGLEQLYRRYRDQGFAVLGFPSNQFMQEPGSNEAIAEFC
    ERTYQVTFPLFAKVDVNGPNEHPLFAYLKRQQPGLFGSTAIKWNFTKFLVDRNGKPYRRYAPTDLPSVIENDIVALLRQQ
    PATVG

    >gi|219847293|ref|YP_002461726.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chloroflexus aggregans DSM 9485]
    MKRLIIFLSLTILLAACTQTSQTNPPLVVGETPIATESTLIDRKPDWAAIPGERAPDFSYTLPDGVHKLSDLQGKPVIIN
    FWATW
    CLPCVEEMPTLEAARRANPDLVILAVNRSESTEAISAFAPKVGVSFPLITDRDGVIGERYGVVNLPTTFFINRDG
    TIAVRHVGALTSERLAERLAEVK

    >gi|219847393|ref|YP_002461826.1| Glutathione peroxidase [Chloroflexus aggregans DSM 9485]
    MNVYDFSARTIDGVIQSLADYRGNVLLIVNVASYCGLTPQYGDLESLYRRYRERGLVVLGFPSNQFNQEPDDEETIKAFC
    IRTYAITFPLFAKIEVNGPNTHPLFAYLKAQQPGSSPDGEIKWNFTKFLVNRNGIPVRRYAPTDTIGSIERELVELL

    >gi|219847445|ref|YP_002461878.1| DSBA oxidoreductase [Chloroflexus aggregans DSM 9485]
    MSVQSTRGRRVKAARTNNLLYLYIAVGVIAVIAITALVVLLTRNTAEITTPTAPVGRTDDGFYYKGNPDAPVKVIAFEDY
    Q
    CPGCAFFTRNLEPILERDYINTGKVQFIYHELPLTNIHPNALPAAEAARCAGDQGKFWEMHGQLFANQSIWSQLNSPLN
    TFSGYAGIIGIDRAAFDSCMQAATHREAILAAAQSAAELGVQATPSFSVNGQIVDSNRLFTAIDAALRAAGR

    >gi|219847461|ref|YP_002461894.1| DSBA oxidoreductase [Chloroflexus aggregans DSM 9485]
    MMRISPLWIVVLVVLFVGCGSAAPPAPTRSPVEIRQTQVALQGLPTVPPAPTELTQPTSIPRPTPDVVALLNLTPDDPRA
    LGDPNAPVLMIEFTDYE
    CPFCARFVSETRSRLISEFVEAGIVRLVVRDFPLTSIHASAVLAASVAHCAAAQDRFWPVYEM
    LFQTHNVEWGGVPRRDRPVLVELAGKLGVDTAQLATCLDDPATEAAVLNEVALATQLGINSTPNFLINGQIVRGALPFEN
    FASLIRQLAKP

    >gi|219847466|ref|YP_002461899.1| Redoxin domain protein [Chloroflexus aggregans DSM 9485]
    MTIERPEAFVFFGPQTVVGPELKPGDKAPDFKLVNNKMQEVTLADFAGKPLLISVVPSLDTGVCSKQTTRFNEEAARLAG
    QANFITVSADLPFAQARWCGDHHADAIQTLSDHRDMNFGMAYGTYVPAYRIEQRAVFVVDGDGIIRYSEYVPVAGQEPNY
    DAALVALKALL

    >gi|219847602|ref|YP_002462035.1| Thioredoxin domain protein [Chloroflexus aggregans DSM 9485]
    MVGVTNKASVTTAQEAVIEVNEATFERDVLQRSQTTPVVIDFWAPWCGPCRVLGPTLERLAHEAGGSWVLAKINVDENPR
    LAQMFRVQGIPAVKAVYQGKIVDEFTGALPESQVRAWLKRVVPDPNADLLAMAQALEATNPAEAIARYRLILGQDPKNET
    ALFNLGRLLALRGDPEGIVTLKQVPASSSFSSRATAGLAIANLVNAPAEPAEGSEGLYRQAAAAVRAGDYATAIEQLLTI
    VGRDRALRDDGARKALLALFALLGDDHPLVGPARRRLANLLF

    >gi|219847870|ref|YP_002462303.1| UBA/THIF-type NAD/FAD binding protein [Chloroflexus aggregans DSM 9485]
    MSEVTLSNEEIARYSRHLIMPEVGMAGQRRLKQGSVLLIGTGGLGSPLALYLAAAGVGHIGLVDFDVVDASNLQRQIVHG
    TGTVGIAKTESAKRRLQDLNPYIEITTHETRITSENALELMRPYDVIVDGTDNFPTRYLTNDACVLLGKPNVYGSIFRFE
    GQVTVFSARDGGPCYRCLYPEPPPPGLVPS
    CAEGGVLGVLPGVIGTIQATEVIKLLIGIGEPLIGRLLLYDALAMRFREL
    KLRRNPSCPVCGDHPTITELIDYEQFCGLVEEPTLSNQFEITPRELAEWLERPDRPFLLDVRNPYEVAIASIPGTDKLIP
    IDQLPERINELDSAREMVVY
    CRSGARSGRAVELLKSVGFRKVKNLVGGILRWADEVDPSLPKY

    >gi|219847875|ref|YP_002462308.1| Rhodanese domain protein [Chloroflexus aggregans DSM 9485]
    MSGYAHPEALVETQWVADHLNDPHVRIVESDEDLLLYDTGHIPGAVKIDWVQDLNDPVIRDYLDSERFAALMRAKGISND
    TTVVLYGDKHNWWATYAFWVFKLFGHRDVRIMNGGRAKWIAEGRPLTREVPVYPPGSYVAPPRDDSTIRAFRDQVLEFVR
    QRKGVLVDVRSPQEYTGERTHMPDYPQEGTLRGGHIPTAVNIPWARAVNEDSTFKSVEELRELYATHGVTPDKEVIAY
    CR
    IGERSSHTWFVLTYLLGYPHVRNYDGSWTEWGNSVGLPIEKNV

    >gi|219848041|ref|YP_002462474.1| dihydrolipoamide dehydrogenase [Chloroflexus aggregans DSM 9485]
    MSEQVYDLVVLGSGPGGYVAAIRAAQLGMKTAIVEVNALGGVCLNIGCIPTKALLHSADLLEEVKEAKRFGITVENVAFE
    LAGAMKHKDTVVKQSTDGVAFLMKKNKIEVVAGRGRLIGRGQVHVQLNEGGERVLAAKYIIVATGGRPRPFPGVPFDGER
    VLSSTDMLNLKSVPASFLAIGAGAIGVEFASMFRSFGSEVTIVEALPRIVPNEDEEVSAELTKAFQRRGIKTLAGAKVES
    IDVGGEQVVVTVLDSAGKPQQIAVEKLLVSIGIAPNTENIGLEEVGVKVNSRGFIETDGFLRTSAEGVYAIGDCTANTPW
    LAHKASAEGILAVEHMAGHHVTPIDYGKIAACTYCNPEIASVGLTEAKARERGYQVKVGKFPFSANGKARVLGQTRFGFV
    KLVADAQYGEILGVHMIGPRVTEMIAEGGIALSHEATGESMMQTVHAHPTLYEAIGEAAHALVHGAPIHL

    >gi|219848059|ref|YP_002462492.1| Rhodanese domain protein [Chloroflexus aggregans DSM 9485]
    MQRFGLALLLMTTIVLTACGTAATTTSPATKLPAEINVARLKTMLDRQENFFLLDVRTPQEFVQDGRIAQSTLIPLQELE
    QRLSELPTDKPIVCI
    CRSGNRSAAACDLLRSRGFEVINVAGGMRAWAAAGYPMVVGP

    >gi|219848062|ref|YP_002462495.1| Rhodanese domain protein [Chloroflexus aggregans DSM 9485]
    MFRQLFRNQRETQANQIGTMTVQELKAKLDSREPIVLVDVRQPEEFAYDGHVAGARLLPLPMLAMRMNELPKDQPIVCIC
    RSGNRSQVACEMLQRHGFTNVTNVVGGMIAWQRSGYPINRQ

    >gi|219848066|ref|YP_002462499.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chloroflexus aggregans DSM 9485]
    MVRPIVPLTDKFINELVRPRGPANVPAVGSEAPDFTLPYAQFLSGPPEDRVEYGRTITLSALRGRPVVLNLSRIFSERVF
    CPNCAPHLAALRTQYNEFSRRNVHLLVVSSTDLETTSYVAEVLRAPFPILSDPDWKVFTGYGMGSAFGAPLPGVFIIDAQ
    GIIRWSWVAPFSPIFSPPPIEELTAVLDSIGATPTTTA

    >gi|219848268|ref|YP_002462701.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chloroflexus aggregans DSM 9485]
    MRSPLKRDWFLVTLIIAGISWIIISRPPDIQPPTISPRPGFIAPTIALPQANDQTIVLAELQGRVVVVNFWASWCGPCRA
    EMPTLERLYQAEQDRGLIVLAVNQTMQDSETAVMAMQRELGLSFPIVFDRDGTTAERYGIRMLPTTFIIDRAGVIRHVFF
    GGPLSEAHLRSVIEPLLTE

    >gi|219848469|ref|YP_002462902.1| OsmC family protein [Chloroflexus aggregans DSM 9485]
    MGSVINASVRLREGLHFTAVADSGRPIELDSPHEGKSDLAGPSPMETVLMALSGCTAMDVISILRKKRQPVTGLEVRAQG
    TRGDEYPKPYTEIELVYRCSGNVEPAALERAIELSRERYCPVWRMLGATVTIRYRYEIVPSLDEAN

    >gi|219848471|ref|YP_002462904.1| glutaredoxin-like protein [Chloroflexus aggregans DSM 9485]
    MSLQPIIVYGTNWCPDCRRAQRVLDQHGAHYTYINIEHDPAAAEFVIKVNNGNRSVPTIVFPDGTILVEPSNRVLQEKLS
    QFA

    >gi|219848522|ref|YP_002462955.1| Rhodanese domain protein [Chloroflexus aggregans DSM 9485]
    MTLTLPAGPLVETDWLAAHLDHPRLRIVDMRGTVLPPTAPKPHYFARHEDYAKGHIPGAVYIDWTRDIVDLDDPTPVQVA
    PPEKIAHELGKRGIGDDTVVVAYDDWYSMFAGRLMWVLRYYGFENVRILNGGLVKWMAEGRPLTTEVPNYPPATFTPRPQ
    PHLRKTADQVLQALGSDLLLIDARSEQEYRGLESRAARGGHIPGARNIFYQSLVSGPHQTYLSPDQLRERFRAAGIDPDT
    IGDREVVAY
    CNGGVSATPTAIAFELISGRRVAIYDGSWNEWGNDPDKPLEQ

    >gi|219848755|ref|YP_002463188.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chloroflexus aggregans DSM 9485]
    MSSMTGHTYYSLLGVSPTADQAAIAAAYEQQRQRYDPARLADLDGELATIARQRLAELEHAYHVLSDPERRRQYDISQGI
    TAPSTPPVRRTPSRKEVISAFIFSFLAVGLVAIVWLMTNRDTVNTPPMGQLDRPAPNFTAPELRGGTVELAQYRGRVVLI
    NFWGTW
    CEPCKRELPALQQAYEQFAEQGLMVIGVNLTDDEQVNGKTVEDVAAFLAQYGVTYPIALDVDGKIAEAYRIFPL
    PTSYFVTTDGQLRYVHIGELTFADIAARFAELRPVGDKQP

    >gi|219848944|ref|YP_002463377.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chloroflexus aggregans DSM 9485]
    MTTPPQVGDQAPDFTLPNEAGEPVSLSQFRGKRVILYFYPKDDTPGCTSQACGFRDAYPQIEEQNAVVIGISPDSTKSHT
    KFKTKHNLPFILLADEEHRVAEAYGVWGEKSMMGKKYMGIIRSHFVIDEEGRIVQAEVKVSPADSVKRALAALGVKP

    >gi|219849005|ref|YP_002463438.1| sulphate transporter [Chloroflexus aggregans DSM 9485]
    MLSFGHSVAQLFTRPVRLVRSFTPETLRADFLAGLTVGLVLLPQSLAFALLGGLPPITGLYTALTATIVGALWGSSSHLN
    SGPTNTAAIITLSVLAPVVRIDSPEFVTAASLVAVMAGIIRVIMGIARLGILVNFVSDAVSVGFTAGAGILILSNQIGPL
    LRIDLPPGADPITTVTETARHLDAIHWPSLAVGVATIGIILFSPRITRKIPSVLISIVIVSPIVWFLNLKAQGVRVMGPV
    PPGFPPLAQLPIFDLDLISHLLNGALALAIIGSVEAVAIARAIAGYTGERIDSNQEFVGQGLANIASGIFSGMPCSSSFN
    RSALAYQSGGQTALTGVVSGITVFLATTVLGPLLAEVPRAALAGALAVTAWSMVDRRNMARIWRGSRSEAAIMIITLVLT
    LTLPLQFAILTGVLMSLGYYLLRTATPRIEAVVPDTAFRHWDPAHGRPTCPQLLVVDLQGDLYFGAASHVEEALLRLLDQ
    HRTVRYLLLRMHSVNHCDVSGIRALETIRRTLRVRGGDLYFVRVRAGVMYRMQISGFYEQLGPERFLDEDTAIEFLFHRV
    LDPAVCIYECDRRVFRECQALPKQTLPGHLTIPLLDGKLPAQINARALWEALHSPQPPAVIDVREPREFQRGHIPGARNI
    PLSRLLSERDTVPAGPVVLV
    CRSGRRSLRAAALLVERTPPPQVLEGGMLAWEAANLLEAVEQA

    >gi|219849006|ref|YP_002463439.1| sulphate transporter [Chloroflexus aggregans DSM 9485]
    MSDYLRSVITLFAQPIRLIRTYPIDALRADFFAGLTVGLVLLPQSLAFAILGGLPPIVGLYSAMTATIIGALWGSSSHVN
    GGPSTTSAILTLSVLLPIAPIGSAEFVTAASMIAVIAGIIRLIMGIARLGMLVTFISDAVAVGFTAGSGLLILFNQFGPI
    TKLSISPGASIPTIVQETVTQLTEIHWPSLIIGASTIALIYLLPYITRAVPAALLSMIIVTIVTTFLNIEQYGVRLIGDI
    PPGFPPLAQLPWFDIGLIGQLLNGALALAIIGLVEAVAIARAIASYTGQRIDSNQEFVGQGLANIVSGLFSGMPCSGSFN
    RSALAYQAGGKTALTAVISGLTALAGTAILSQVLAIIPRPAIAGTLMVAALGMVDRRGMARVWRGSRGEAAIMIITLVLT
    LTLPLQFAILTGVLMSLGYYLLRTATPRIEAVVPDTAFRHWDPAHGRPTCPQLLVVDLQGDLYFGAASHVEEALLRLLDQ
    HRTVRYLLLRMHSVNHCDVSGIRALETIRRTLRVRGGDLYFVRVRAGVMYRMQISGFYEQLGPERFLDEDTAIEFLFHRV
    LDPAVCIYECDRRVFRECQALPKQTLPGHLTIPLLDGKLPAQINARALWEALHSPQPPAVIDVREPREFQRGHIPGARNI
    PLSRLLSERDTVPAGPVVLV
    CRSGRRSLRAAALLVERTPPPQVLEGGMLAWEAANLLEAVEQA

    >gi|219849008|ref|YP_002463441.1| methylated-DNA/protein-cysteine methyltransferase [Chloroflexus aggregans DSM 9485]
    MQPALTITLTASPLGRLLVATTQHGLAAVCLGDDDSSLVAALRTTFSAASIHVGDEPLAAAAAITAYLRNETDLPPLPLD
    LSAGTSFQQRVWRALQAIPRGSTRTYGQLARDLGLPITAARAVGRACATNPLAIVVP
    CHRALGADGKLHGFRWGIERKRA
    LLALEGVLLPEG

    >gi|219849085|ref|YP_002463518.1| uncharacterized peroxidase-related enzyme [Chloroflexus aggregans DSM 9485]
    MNDSVRPISRFPYPDQIDNLPPDIRERIEKVAEKSGFIPNVFLALAARPDEFRAFFAYHDALMERPSNLSKAEKEMIVVA
    TSAANDCLY
    CVIAHGAILRIRSKNPRLAEQIATNYRRAEITPRQRAILDYALKVAVDSARIGEEDWQPLYQYGFTQEDIW
    EIGAIAAFFAMSNRLANMSALRPNDEFYAMGRHFD

    >gi|219849212|ref|YP_002463645.1| protein of unknown function DUF255 [Chloroflexus aggregans DSM 9485]
    MSTGARPLNRLASEASPYLQQHADNPVDWYPWGEEALERARREDKPLLVSIGYAACHWCHVMAHESFADPEIAAIQNEYF
    INIKVDREERPDLDSIYMAAAQALTGRGGWPLNVFCLPDGTPFFAGTYFPPDAKANRYRMPSWRQVLLSIAEAYRTRRDD
    LTASAQELLNHIKLLAQPLPETATVDEALLLEAAAKLEREFDPQYGGFGDAPKFPQPLVLEFLLRTHLRGHVQALPMLHQ
    TLEQMAHGGMYDQVGGGFHRYSVDTRWLVPHFEKMLYDNALLAEVYHLAALVTGDPFLAQIADETFAYLLRDLRHPEGAF
    FSSEDADSLPVPGAAHAEEGAFYVWTPDELRLALGDDATIVGAYYGVTRQGNFEGKSILYVPRSASAVAARLGVPVERVT
    ETVERARPILRTFREQRPRPFRDEKIITAWNALAIRALATASARVPEYLSAARQCADFLLANLRRADGRLLRSWKDGRPG
    PAGFLDDYALLCDALLELHAAGGETYYLATAIELAEAMLDLFWDAQSWMFFDTGRDQPALVTRPRDLSDNATPSGTSAAT
    MALLRLYALTGNDLFATRAEQVLQQVAPMLIRFPLGFGRMLCAADLMIGPIRELAIIGPSGHPATQALLAVARSAYRPRL
    VIAHAEPGDPIAEQVALLAGRTLIDGQPTAYLCERFACRLPVTTPEALLEQLG

    >gi|219849379|ref|YP_002463812.1| peptide methionine sulfoxide reductase [Chloroflexus aggregans DSM 9485]
    MPLETATLAGGCFWCLEAVYDQVIGVKDVVSGYTGGHVPNPSYQRVCDGNTGHAEAVQIQFDPEQIGYRELLEIFFSIHD
    PTTLNRQGADVGTQYRSAIFYHSEEQRQIAEQLVRELTEQRVFRDPIVTEIVPASTFYPAEDYHQEYFARNPYQPYCQFV
    VAPKVAKFRKLFADKVAQ

    >gi|219849508|ref|YP_002463941.1| pyruvate flavodoxin/ferredoxin oxidoreductase domain protein [Chloroflexus aggregans DSM 9485]
    MGSRRVTLDGNEAVANVAYQLSEVIAIYPITPSTPMGELADAYAAAGKPNLWGVVPTVYEMQSEGGAAGALHGAMQTGAL
    TTTFTASQGLLLMIPNMFKMAAEMTPGVFHVAARAVATQALSIFGDQSDVMAARTTGVGMIASASVQEAQDLALIAHASS
    LAGKLPVIHFFDGFRTSHEVNTIIQLEPEEIRAMIKDEWVHDQRAHALSPEHPVIRGTAQNPDVAFQARERIQPILDAFP
    NVVQEQMDRFAAITGRQYHLFDYFGAPDAERVIVIMGSGGETARETAFYLHRQGEKVGVVMVRLFRPFAAEAFRAVLPPT
    VKAIAVLDRTKEPGASGEPLFLDVVSALRNQPITIIGGRYGLSSKEFTPGMAAAVFAELAKPHPKEHFTVGINDDVSHSS
    LSYDPDLCIDPPGTVRCVFWGLGSDGTVGANKNSIKIIGDSSEGEAERYAQGYFVYDSKKSGSVTISHLRFGPSPLATPY
    LIGKGQAQFVACHNFSFLERFDILQYAAPNGVFLLNSPYGPDQVWHQLPTVVQRKIRDLNLRFYVIDATAVANEVGMRGR
    INTVMQTCFFAISGVLPREDAIAAIKQSIKKTYGRRGEAVVKQNWAAVDRTLDRLYEVPIPPPSEDNGLPMRPPVPEHAP
    PFVREVLGPMIAGRGDELPVSAIPIDGSFPTGTTKWEKRNIAIEIPVWDPNI
    CIQCNKCVFVCPHATIRAKVYPEEALAG
    APEGFQSAPARFKEFPGQRYTLQVAPEDCTGCGLCVEACPVKDKRAVGRKAINLQPQAPIRAREAAYWDFFVSLPDVDRT
    LIPSGSVKHTQLYVPLMEFSGACAGCGETPYLKLLSQLFGDRAIIANATGCSSIYGGNLPTTPWTTNAEGRGPAWCNSLF
    EDNAEFGLGMRLSIDQQLAHAHMLLNQLRPILGAEFVEDLLNADQHTEVGIREQRERVAILKQRLRELIDGNPPEVNTMR
    DLLALADVLIKRSIWIVGGDGWAYDIGFGGLDHVFASGRDVNILVLDTEVYSNTGGQASKSTPTGAVAKFAARGKGGVKK
    DLAQIAMTYGDVYVARVAFGADDVQTLRAFQEAEAYPGVSLIIAYSHCIAHGYDLRRGLEQQRLAVETGIWPLYRYNPAI
    HEGSPLTIDSKAPSLDPEVYLRGEGRFQMLQQANPARYEQLLNSLRRQVALKWAHLQWMANELVAETKEGLR

    >gi|219849556|ref|YP_002463989.1| thioredoxin reductase [Chloroflexus aggregans DSM 9485]
    MHHKVVIIGSGPAGLTAALYAARANLEPLVIRGLQPGGLIATTSEVENYPGFPEGIGGFELAEAMEKQAARFGTQYLDSM
    VTKVDVDQRPFVIHTDGGQTVTADAIIVSTGASPRKLGVPGEAELANRGVSY
    CATCDGFFFRGKKVVVVGGGNSALDEGL
    FLTRYVDELVIVHRRDTLRADPVLQERAFNNPKVRFIWNSTVVAINGKDKVESVTLRNLKTGEMSELPTDGVFPYIGHVP
    NTELFRGILELDEGGYIVTDGRTRTNIPGIFAAGDVADHIYRQAVTAAGDGCRAAMEATWYLAEQEHARAKATATASA

    >gi|219849569|ref|YP_002464002.1| heavy metal translocating P-type ATPase [Chloroflexus aggregans DSM 9485]
    MMHNQQFTIKGMDCPDCARTVERGVARLAGVKTCHLNFTTEQLHVTGDVDPETVIARVRELGYEAQPTTSAVSEAPPSFL
    RFMLSIRETKRALIGFLLVLPGIVLHEILGWEAWWIDALALGGLALVGPSIAHHAWRVLRTNRELSIDALMTIAAIGAIV
    IGAYVEAGLVMVLYAIGEALEGYTANHARHTIRSLLELTPPTATLITPDGEQVTAVENLHPGDRIIVRPGERVPVDGTIT
    AGSSFVNQAPITGESRLVERSVGDEVFAGTMNGEGSIEVIVTRPAAESTVARMIHLVQEAQERRAPIQRFVDRFARIYTP
    LVVLLAAIVALVPPLFFGQPFWNPDPNTFGWFYRGLALLVVACPCALVISTPVSIVSALSTAARHGVLIKGGAYLEALAR
    VQTIAIDKTGTLTTGKPAVVTLRTVGCIKPEAPLGHCTACNELLALAGAVERRSEHPLAYAIVNAANTCGLTLPSAAEVR
    TLVGQGVRGIVNGTEVFIGSHRTFDQVMTHDEWHCLAAHRDSQLGRTPVMVGVDGQYRGTITVADTIRAESRSAIARLRD
    QGLRIVMLTGDETATAERIAAELGVDDVRAGLLPADKAQTVQALRQTNGVVAMVGDGINDAPALATADVGIAISARAGGT
    TQAMETADITLLSGDLHQLPFAIALSRQTLRTIATNVAFSIGIKLFFIGLVLAGLGTMWMAVLADVGASLLVTLNGMRLL
    RFRAKLPVAYDQAA

    >gi|219849603|ref|YP_002464036.1| electron transport protein SCO1/SenC [Chloroflexus aggregans DSM 9485]
    MYRLILLLLVLLGACAVTGPSSTTTPTKIDRPTVLSDFTLPASTGGELSLSDLRGQPVLLYFGYTRCPDYCPITLGEFRR
    VRDELGPNGMRVHFVLISVDPANDTPDVLAAYLRGFGEGFIGLQGDDATLRRISKEYGLTYRHGGGHHGNSGVDHSTASY
    LIDQKGRLRVVYQYGTAASVYVNDIRALLSEQP

    >gi|219849651|ref|YP_002464084.1| DSBA oxidoreductase [Chloroflexus aggregans DSM 9485]
    MGIHRFLWLSLLILTACTGQTATVPATPTLPPPGAPTSTPVTAQSDPIVTAYYPDLPRGRTPEGYHYLGNPDAPVTIMVY
    SDFL
    CTTCAIYTLDLEPQVIEAFVVTGKARLVYRHLLQLGERSQLLAEASECAADHGKFWEMRHELYARYNQLYFNTRET
    TIDLAQGLGIPADAFSACLDAHTYRAQVEADYSAATAEGVFARPVFRIGNETLVGMPRFEALAQVIERAAQR

    >gi|219849832|ref|YP_002464265.1| electron transport protein SCO1/SenC [Chloroflexus aggregans DSM 9485]
    MGLDIALPATTNELTTRRQVIIRLLFGLGIILIGGLIAAFLWFVIARPVKVLPRGEPLPPFALTDQRGNRLLDSDLRGRM
    VFISLMHSRCGDE
    CAEQNRRLLELRQALQTAGRLGSEVLFLTITLDPAHDTPADLSALAGQLGVDPQSWRFVTGDPRDVK
    MLVGGGLGVYYTEPDETGKLYAERRTFLIDPVGNVRTSYPADGPPLAIALRDVDLIAREMGSQGAMRLVYEASHLFVCYP
    E

    >gi|219850129|ref|YP_002464562.1| glutaredoxin [Chloroflexus aggregans DSM 9485]
    MWQLTLYGAADCDDTAQTRALLHERQIVFHEHAIDNDPVAEQFVVFINGGYRSTPTLVFTAGRFKLVVTEPTADELMLAL
    QIANRLPSPVTERGGGHNDSDSDSRL

    >gi|219850132|ref|YP_002464565.1| DsrE family protein [Chloroflexus aggregans DSM 9485]
    MKALFILNDAPYGSEKAYNALRMAMALQKDYPDVEVRVFLMADAVTCALPNQTTPQGYYNIERMLKAVISKGGQVKACGT
    CSEARGIKGLALLDGVEISTMSQLVQWTVEADKVLVF

    >gi|219850176|ref|YP_002464609.1| Thioredoxin domain protein [Chloroflexus aggregans DSM 9485]
    MKMTEYQNHLRTYTQPVVVDVWAPWCMPCRVTRPILKRLAQEYQGRVALWEVNAEEHPDLLRELRIYGIPTLIAYRDGQE
    VSRQLGAKSEAELRSLFQHLAEGKTPPRLQPLERLLRIMIALVLVGLVWFGVGGWPLLVLAGLIFFSAVYDRCPIWKAVT
    SWVRDVTAKRSTGRTP

    >gi|219850260|ref|YP_002464693.1| copper-translocating P-type ATPase [Chloroflexus aggregans DSM 9485]
    MAEREIILPVTGMTCASCSARVEKALRKTPGVLSAEVNLASEQVLVRFDPAQAQPSALQAAIEQAGYGVVTDEIALAITG
    MT
    CASCSARVEKALRKTPGVLSAEVNLASEQALVRYVPGMMNRAELVKAVEQAGYGVIAPATTTGETEDVEARARAHEMA
    LRRRRLLVGVVFGLPLFILSMARDFGLIAPWLIGEGAAMAAAMAGSAMNEIMHMVAARDDLLNWLFLALATPVQFYAGRD
    FYRYAWRALRMRTATMDTLIALGSSAAYFYSLAILLSGAPGHVYFETAAMIITLILVGKYLEARAKSQTSAAIKALIGLQ
    PKTARVLRGGKEVDVPLNEVRVGEMVIVRPGEKIPVDGVIIAGESTVDESMLTGESLPVEKRIGDPVFGATINRSGSFQM
    RATRIGKDSALAQIVRLVQEAQGSKAPVQALVDRIAAVFVPAVIVIATLTFVGWLWAGVGLTQALIFAVAVLVIACPCAL
    GLATPTAIMVGTGAGAAHGILIRNAEALERAASLQVVVFDKTGTITYGRPEVTDVVVVTQPVLVQHGAVELPADAALLQL
    AAAAESRSEHPLGVAIVQAAQARGLPIERPTRFQAVSGAGVEAEVNGQTVLIGTPVWLAERGVDVTGLAATVDQLQASGK
    TVIVVAADGEARGVIALADTVRPTAVAAVAELCRSGLDVALLTGDNQRTAAAIAAAVGIPTNAVYAEVKPHEKAAIVARL
    QQSAAGDKPRRVAMVGDGINDAPALAKADIGIAMGSGTDVAMETADITLMRSDPRGVAQAIALSRATVRTIRWNLFWAFA
    YNVILIPVAAGVFYPFTGWQLSPVLAAAAMAFSSVFVVSNSLRLKGVRF

    >gi|219850309|ref|YP_002464742.1| thioredoxin [Chloroflexus aggregans DSM 9485]
    MAKPIVVNDADFEEKVLKSSTPVVVDFWAPWCGPCRVIAPILDKLAGEYEGRLTIAKVNTDDNIRYASQLGIQGIPTLVI
    FKNGKEVGRLIGARPEAMYREVFDKVLAMA

    >gi|219850435|ref|YP_002464868.1| thioredoxin [Chloroflexus aggregans DSM 9485]
    MVFSTPIRTGEQSIDRVLKAGLPVLLVFERRDCATCRQLDATLDRLAQQFAGKALIARIDVDDNPALVQKYSISDLPGLV
    FIRNGATLARTAGAAPATALQAWLNFLCGEGPQPPLPNGPSVPLAKAATSNGRTPSNGSYQQPTGQAQTATGPVVLRDAT
    FDQVVGQSQQPVLVDFWAPW
    CGPCRAVAPSIERLAHEFAGKAVVAKLNVDENPYTAQRFGITGIPALYIFKGGRVVERLV
    GAQPYQVLRQALARHVG

    >gi|219850456|ref|YP_002464889.1| DSBA oxidoreductase [Chloroflexus aggregans DSM 9485]
    MTYHRSQSKLLHSCTLIFALCIVLAGCAATANMPTPSPTIARLPTVTPEPLAAPTPTARIIRLGETSIPTPSTTALPTPL
    ITDSGVLTASMARLGLSAEPYAVLGDPNAPVTIVEFTDFG
    CPFCRRHHLLTFRTLVEEFVATGRVFYVIKHLPVSSQQGE
    QAALAAICAGEQGRYWEMHNALFADGEAWQGNETIAQRRIDAIAAELGFDVAALRACTERTDTKAIIARHVSEAHTLRVF
    GTPVFFINNRLLAGAQPIEVWRQVLAVGAQRCCAPTGDGVGCGCGRARLLWWY

    >gi|219850502|ref|YP_002464935.1| iron-sulfur cluster assembly accessory protein [Chloroflexus aggregans DSM 9485]
    MTMIGVDQIGVQSTNPQPLLMISEAAVNRLLKMMQEKQLEGYALRVFVAGGGCSGLQYGMTFDDEVREGDNEFYAGNLRV
    LVDPISVNYLMGASIDFVDTLMGGGFKIDNPNAVSSCGCGHSFRARDTDYSEEDDDAPVGGGCGTCGY

    >gi|219850513|ref|YP_002464946.1| redox-active disulfide protein 2 [Chloroflexus aggregans DSM 9485]
    MVDVKVLGPGCPNCQKLEARVRNVIQRYQLAASVEKVTDYAQIMRWNVMRTPGLVVNDVLVSAGRIPSEEEIAGWLKQ

    >gi|219850268|ref|YP_002464701.1| electron transport protein SCO1/SenC [Chloroflexus aggregans DSM 9485]
    MQRWFLRFIVLIAALVLSGCTAYEFRGTVLEPPNPAPELPLTDQFGRDFRLSDYRGKVVLLFFGFTHCPDICPTALGDLK
    RVMEKLGNNAEKVQVVFVSVDPERDTPDLMQRYLASFNPTFLGLNGDRVILEQAYKDYGVTVIRRDLPNSGLGYTIDHSG
    YIYAIDQVGNWRLLWAHGTPVDDIVSDVQALLRNPPRS