Aeromonas hydrophila ATCC 7966 uid58617

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|117619313|ref|YP_854548.1| glutathione-disulfide reductase [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MAQHFDYIAIGGGSGGIASANRAAMYGKKVALIEAKELGGTCVNVGCVPKKAMWYAGQIADALKYGADYGFDTTLNHFNW
    AKLVESRQAYIGRIHQSYQNVLGKNQITVIKGFARFVSSNTIEVNGEQYSADHILIATGGRPEVPAIPGAELGIDSDGFF
    ELQSQPKRVAVVGAGYIAVEIAGVMQALGSETHLVVRKHAPLRNFDPMIHETLVEIMAQEGPKLHTHAIPKAVVKNADES
    LTLQLEDGRHLTVDCLIWAIGRVPATDNLNLAAAGIELDEQGFIPTDKFQNTAVANVYAVGDNTGRIQLTPVAVAAGRRL
    SERLFNNKPGEHLNYDLVPTVVFSHPPIGTIGLTEPEAIAEYGEGQVKVYRSQFTAMYSALTQHRQPTRMKLVCVGPEEK
    VVGLHGIGFAMDEILQGFGVAMKMGATKADFDNCVAIHPTSAEEFVTMR

    >gi|117617736|ref|YP_854623.1| thioredoxin [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MSDKIVQLSDASFEADVIKADGAVLVDFWAEWCGPCKMIAPILNEVAQEYAGRVTVAKLNIDHNADTPPKYGIRGIPTLL
    LFKNGEVAATKVGALSKTQLKEFLDGNL

    >gi|117617882|ref|YP_854635.1| thiosulfate sulfurtransferase GlpE [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MDQFAHISAHDAHQKLAAGAARLVDIRDPQSFETAHAVGAFHLTNGTLVRFMNEVDFDTPVIVMCYHGNSSQGAAQYLLQ
    QGYDEVYSLDGGFEAWRREFPIQAGDA

    >gi|117619220|ref|YP_854763.1| YeeE/YedE family protein [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MKWALMALIGFGFGFTLSFSRFGIVFGWREMLTKRNSYYVRVHLLTIAIEILLFTCFLSFSHALFGDAMVGNVMAIGIPF
    IVGAFLFGIGMQLAGV
    CATGTLYCCGEGQPRFWLVLLCYGIGTLISNQLRPELEATFSSHVVLAKDLTGNIWSGMLLNLA
    LVAALFLLFRKSELKRTGELKPLFSGGNLFWRDGRFTVLTGGIIIALLNSSVVALHGSAWTITGAVYDMALRGASLFGLF
    EGNPKLAQPLFINPMVGMFWLGILGAMLARCISGGGTFAPMRLGNSLASILGGLLMGMGAMYSA
    CNLGGFFDGTASGSLH
    GWVWMLMALAGSLIGIRLRPLFKL

    >gi|117618411|ref|YP_854824.1| rhodanese domain-containing protein [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MQEYLDFAARNPLLTAAWFGLAGTLVYTTVRARFSPVKSVNNHTATLLINRENATVVDIRSQEEFAKGHLAGAQHLPLSQ
    IQSNNLGPVEKHKDAPIIVV
    CESGMTAGGAGRQLSKAGFKQVYVLSGGMAQWRAENLPVTKKR

    >gi|117620639|ref|YP_854970.1| thiazole biosynthesis adenylyltransferase ThiF [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MLADAEYLRYGRQLMLAEVGEEGQARLKDKSVLIVGLGGLGSPLALYLAGAGVGTLWLADGDTVDSSNLPRQILFDSEAV
    NHSKAELARERLAAHNPLVELIAINQRLDAASLPEFVAEVDLVIDCCDNLATRQAINAACVAQGKPWVCAAAVGWQGQLM
    VRTSSEHACYACLYPLDTEIKES
    CETSGVTGPLVGVMGSLQALEALKLLFGMQSPVAGTLRRFDALAHQWQTLTLAPDPD
    CPVCGPHKEITP

    >gi|117621449|ref|YP_855169.1| zinc/cadmium/mercury/lead-transporting ATPase [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MDLTPRFTLGSVIEDLAPAGSIQEGLIMSKSCCSHQHAAAPIKAVSKSAAPQAEHQHDSHCCDQAAPVSCCASQAPHDHQ
    DHAASGAPEGEEPPRGGCCATPPPAHARHAHDGEHDHHEHAVAAEPPLDAPEQNSRRHSWQVLGMD
    CPSCARKIETAVSR
    VSGVQQARVLFATEKLVVDLAPGLSPDPVTAAVLAAGFQLKGERSGKQEPSRERGPLQTLLTKYWQPLSLAGLMLVAALL
    PSQVGQPLFTLATLWGLWPISRKAWALTKSGSPFAIETLMTVAAVGALFLGETAEAAMVLLLFMLGEHLEAYAAGRARAG
    VTALMALVPDKALRIRTTAEGEVREEVAADQLRPGDIIEIAPGARLAADARLLDALGAFDESALTGESIPVERRQGDKVP
    AGSLAADRVLRLEVVSEPGNNAIDRILHLIEEAETQRAPIERFIDRFSRWYTPAMMLVALLVVLVPPLAFGQSWDEWVYR
    GLALLLIGCPCALVISTPAAVTSALAAATRQGALIKGGAALERLAHIDTVAFDKTGTLTLGKPQLTELVSLNGQPEAELL
    ALAAAIEQGSHHPLARAVVTAASERGLSLAAAQALRALPGMGVEGRIDGTLWQLLAPSRVATLDAAMQARVATLEQQGKT
    VVVLGQPDATPAALLALRDQIRPEAAAALQELNQLGLQSIMLTGDNPRAAEAIASELGMGWRAGLLPEGKVDEIAKLGLS
    QKVAMIGDGINDAPAMKRASIGIAMGGGTDVALETADAALTHNQLGGVAAMIRLSRAALANIHQNIALALGLKAIFLVTS
    LLGITGLWIAVLADTGATALVTANALRLLRKR

    >gi|117618015|ref|YP_855170.1| thiol peroxidase [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MSNSVTLQGNPVSVAGHFPVAGEQAKPFSLVAKDLSDLTLVSFAGQRKILNIFPSVDTPTCATSVRKFNEQASALNNAVV
    LCISADLPFAQSRFCGAEGLDKVVTLSTLRGAAFLQDYGVAFSSGPLVGLAARAIVVLDEENKVLHSELVAEVADEPNYA
    TALAVL

    >gi|117620627|ref|YP_855185.1| glutathione peroxidase [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MKWIMLLLTLGAGAAVAACPDYFNVEMRELNSTQRHNLCQLTEGKVVLVVNTASYCGYRGQFRDLEQLYQTYKEKGLMVL
    GFPSNDFWQEAGDEGKTASVCRRDYGVTFPMFNRIAVRGADASPLYRGLAAAAGEAPGWNFHKYLIGRDGKLVASYGANQ
    NPADDPLQKEVKRALGL

    >gi|117617850|ref|YP_855189.1| methylated-DNA--protein-cysteine methyltransferase [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MKFSFCDSAHGPLLIAIDRDGLRYVEFVLGEQPVTPTDEWQRDDQALAPFIEQFAAYFAGRLRRFDLPLAARGTPFQQSV
    WRALGDIPYGETVSYLEIAQAIGNPKAVRAVGAANGRNPLSIIVP
    CHRVIGRSGELTGYAGGIPIKRWLLALEQQTDDNF
    ALTP

    >gi|117620283|ref|YP_855279.1| alkylhydroperoxidase AhpD core [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MSTRIDYPDFRQLLPAAHDALIAAGKAVDEAGLDKSLSELVKLRASQLNGCSFCLQYHLNIARRSGVGQAKLDQLAAWRD
    ATVFSAPERAALAWTESLTRLPPDGVPDALYGELREHFSEAQIVQLSVTVATINSWNRLGVALRFVPPAAQL

    >gi|117617871|ref|YP_855328.1| thiol:disulfide interchange protein DsbD [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MTPSRLLFPLLLLCALLAGLGSLPARASSTDLLSALGIEASAQPKFLKVDEAFVLESEQQGNRLLLNLRIADDYYLYRHS
    FSFKGENLAFEEPVLPVGSEHEDDFFGKTQVYYREVQIPVTLTEAGQQASLKISYQGCTDGLCYPPTDKLISIQPLTAQQ
    SEQPDQPTPASSQQDQLAAALGNQSFWLSVAAFFALGLGLAFTPCVFPMYPILTGIIAGAGHRLSTRRAFLLSFVYVQGM
    AVTYTLLGLVVASAGLKFQAALQHPYVLIGLSVMFVLLALSMFGLYTLQLPSSLQTRLSGLSNRQQGGSVLGVAIMGMIS
    GLVCSPCTTAPLSGALIYVAQSGDLWLGGAALYALSLGMGLPLLLLGTSGGKLLPKAGAWMDVIKQLFGFALLAVPILLL
    SRLWSDQITTLAWLGWGLLLCGYLYHHNQHQGHSVGRSLRGFVLLLAMISAVVVGKDLLLPPQGASAAAQAETPAFIRIK
    TLNDLKTQLAAARGKPVLLDLYADW
    CVACKEFEHKTFSDPAVRERFGQMVLLQADVTANDDADVVLLNGLNVLGLPTLIF
    FDRAGNELSGQRVTGFMGPAEFLGQLEKLR

    >gi|117617543|ref|YP_855437.1| putative peroxiredoxin bcp [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MQPLSAGSLAPDFSLSDQDGNQVRLADLRGKKVLVYFYPKAMTPGCTTQACGLRDVNAELAALNVVVLGISPDPAKRLKK
    FEERDNLNFRLLADEDHAVADAFGVWGPKKFMGKEYDGIHRLSFLIDEEGKINHRFDKFKTSDHHQVVLDLLKG

    >gi|117620809|ref|YP_855587.1| methylated-DNA--protein-cysteine methyltransferase [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MICYDILPSRCGDLLVAIDEHGLLHVDFVAGLRALPDMSGWQQDKTALAPFLAQFEAYFAGRLQRFTLPLAPRGTAFQQA
    VWQALCDIPYGETRSYSDIARAIGKPNAVRAVGAANGRNPLSIIIP
    CHRVIGQNGSLTGYAGGLPIKQALLTLEGISG

    >gi|117621284|ref|YP_855656.1| outer membrane protein [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MKIKHALLCALTGATLLAAPVQASELTKSDVEQIVRDYLVKNPEILVEMSNALRAKQESQQAESDKTLIKAHAKQLYSNQ
    DPESGNPKGSLTVVEFFDYN
    CGYCKRAHPLIKQLLAEDKDIRYIYKQFPILSETSYFAARAALAVQLGQPDKYQAFHEKL
    YAHQGPLADEAQVKQLAEAAGVNWSKVEAKIKDGSIDQNLGTNRALAEAMSISGTPAFIIGDQILRGAPRDLASLKGFIK
    DVRAGKSIQ

    >gi|117620038|ref|YP_855680.1| NADH:ubiquinone oxidoreductase, Na(+)-translocating, D subunit [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MADKSEMKKLLLTPVLGNNPIALQVLGVCSALAVTSQMKTAFVMTLAVTAVTAFSNLFISLIRNQIPNSVRIIAQMAVIA
    SLVIVVDQVLKAYAYDISKQLSVFVGLIITN
    CIVMGRAEAYAMKSAPLPSFLDGIGNGLGYGAVLLTVATVREILGSGTW
    FGIELLPLVNNGGWYVPNGLLLLPPSAFFIIGLIIWGVRTKDPKQVEAKD

    >gi|117618100|ref|YP_855681.1| Na(+)-translocating NADH-quinone reductase subunit E [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MEHYISLLIRSIFIENLALSFFLGMCTFLAVSKKVKTAMGLGIAVIVVQTVAVPANNLIYNYVLKDGALVSGLDLSFLSF
    ITFIGVIAALVQILEMALDKYFPALYNALGIFLPLITVN
    CAIFGGVSFMVQRDYNFVESVVYGVGSGAGWMLAIVAMAGI
    REKMKYSDVPEGLRGLGITFITAGLMALGFMSFSGISL

    >gi|117620462|ref|YP_855809.1| peroxiredoxin [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MIAIGQALPAGEFTFITAEGKQQRDSQSLFGGKRVVLFAVPGAFTPTCSNAHLPGYVVLADKFKEKGVDAICCLSVNDAF
    VMKAWQDAQNAEAITMLADGDGSWTRALGLAKETGAFGGVRAQRFALIANDGVVEQLFVEAPGKFEVSDAQSLLAAL

    >gi|117619071|ref|YP_855853.1| thioredoxin domain-containing protein [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MIVDIHPQNFQSALIDASMKKPIVIYFHAPQRPECQAMTPLVEALVGPANPQVTLARVDMNDPQLQPLAGQLGLRALPAL
    VLFHQGRPDEQAILEGPQDEATLRHYFAAFAPKEEELLFEQGQQALAEGQADLAYAHLGKAHQLAPERHDISLWLIQAAL
    DLNLLDEAQERLGKIPMIAQDDHYQTLTSRLALAQQAADSPELRALEARHQQEPDNFALAQELAVQYSQAGRQEEALTLL
    FTILKQDLAFGDAKKTYLDILTTMGSNPAAQSYRRKLYSLLY

    >gi|117620028|ref|YP_855938.1| thiol:disulfide interchange protein DsbE [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MSKKTWLFLIPFIVFLLGAVFLFKGLYSDPTKLESVMVGKEVPVFTLQDIYDLNKQHDRSILKGRPMLLNVWATWCPTCY
    GEHTYLKQLAGQGIYIVGMNYKDERAKAINWLAELGNPYQINLYDPDGMLGLDLGVYGAPETFFIDSQGIIRYRHVGDVN
    PEVWASTLKPIYDAMK

    >gi|117617707|ref|YP_855943.1| putative glutaredoxin-like protein [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    METIEKIKQQLAENPIILYMKGSPKLPSCGFSAQASQALMSCGEPFAYVDILQNPDIRAELPKFANWPTFPQLWVEGELV
    GGCDIMIEMFQAGELQTLIKETAAKHKQDDAAAE

    >gi|117619510|ref|YP_856017.1| arsenate reductase [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MRASAAHLPRPGAAPADAAAGSGGVRDPLRPAHLRGEPHSSSSRRQQRHAQLVRIRTAPLVSHPERTLMPAGASRAGHFS
    PPPGPTSASPHLPHAHRRCLEIATMPESDLFLISRFRTQVSAFRAHARRQGLPMATTLYGIKN
    CDTIKKARKWLEQAGID
    YRFHDHRADGLNPADLDRWLSQLGWEALLNSRGTTFRALPDEAKQGLDTAKARALLLEHPAMIKRPLLDRDGELTLGFKA
    DHYQSLFSR

    >gi|117618902|ref|YP_856052.1| alkyl hydroperoxide reductase TsaA [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MVLVGRPAPDFTAAAVLGNGQIVDSFNLASHIKGKAAVLFFYPLDFTFVCPSELIAFDHRLEEFNKRSVEVIGVSIDSEF
    SHNAWRNTKIEDGGIGPVKYPLVADIKHEICKAYDVEHPEAGVAFRGSFLIDKNGVVRHQVVNDLPLGRNIDEMLRMVDA
    LQFHEEHGEVCPAQWEKGKKGMTASPDGVAKYLSENAASL

    >gi|117620890|ref|YP_856079.1| AhpC/Tsa family protein [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MHTLEQKIKAYDEQKQRQVPAPVLALMEEATRSLQASGLEQAALGRGERMPDFALPDQHGVVRPLSHYLAEGPVLLNIYR
    GGW
    CPYCNMEMQALNAVLPALRERGVNLIGMTPETPSSAQDTLTANGLAITVLSDEGNRVSAELGLVFELPEALRPIYAG
    FGIDIPASNGDESFTLPVPASYIIGQDRTVHYHFINADYTRRVEPAALLAELDRLAKAGAL

    >gi|117619830|ref|YP_856085.1| mercuric reductase, membrane-associated [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MKGSRLLLVLVMGCLIGAFFAFDLGHYLSLPQLQARQAELAALVDRHFVSAALLFVVVYVVSTALSLPGASLLTLAGSAV
    FGVVWGLLLVSFASSIGATLAFLSARFLLRDWVERRFGDKLASLQAGMKKEGALYLLSLRLIPIFPFFLVNLLMGLTPIR
    VSTYYWVSQLGMLPGTFVYVLAGSELANLTSTGNILSPGLMVALTLLGLMPVLLKGLQRRLALHRLHAPYRKPTHYDYNL
    LVIGAGAGGLVTSYIAAAVKAKVALIEKHKMGGD
    CLNSGCVPSKALIRSARFAAEQRRASELGFGPSQASADFAAVMERV
    TRVIKEVEPHDSVARYEGLGVECIQGEAKLVSPWEVEVNGQRLASRHIVLATGARPLVPTLPGLEQVPWLTSDTLWQLRT
    APRQLLVLGGGPIGCELAQSFALLGVPVTLVELSDQLLPREEREVAELLAEQLARDGVRVLTGWRAERADYLPAAAGDLP
    IRLQLCRGEEMQVVEGDQLLLALGRVANVSGFGLEALGVELTPRGTVAVDGFLTTNYPSILAVGDVAGPYQLTHAAAHQG
    WYAAVNALFSPFKRFRADYRVMPAAIYTTPEIARVGLNQKEARAQGIPFELTRFELAELDRAIADGERQGFIEVLTVPGK
    DQILGATLVGTHAGERIAEFVLAMRHRLGLGKILATIHAYPTLMEGNKYLAGEWRRARQPATLLALLTRYHRWRRGARPN
    SR

    >gi|117620381|ref|YP_856086.1| hypothetical protein AHA_1548 [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MRVEVKPDREYAWFIRPFFWLQKRNYGQVLIPGKCWGRSPRLFAAVATLYGVINRKRSPIDPVLRSLVTVRVSQLNWCRF
    CVDINAMTLIKRAGSSEKVEALANWRESPLFDERERAVLDYTEAMTGLDGVSDEQAARLKPWFDDDAMVELTGLIAFQNM
    SAKFNAALDIAPQGFCQLPVQPERPAQPDSKDV

    >gi|117621389|ref|YP_856135.1| molybdopterin synthase sulfurylase MoeB [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MSEILSDAELLRYNRQIILKSFDFEGQEALKQAHVLVIGAGGLGCAASQYLAVAGVGQLTLVDFDRVELSNLQRQVLHTD
    ERLGHYKVDSAAQSLHALNPWLKVETHAAVADEALLDTLLPQHQLVLDCTDNLAIRNLLNQKARQHGVPLVSGAAIRLEG
    QVCSFTWQEGEPCYACLSALFGEQALT
    CVEAGVLAPVVGLVGSLQALEAIKLLAGMGRSYSGRLLMIDGLGGTFREMKLP
    KRPDCPVCSHG

    >gi|117620481|ref|YP_856146.1| SelT/selW/selH domain-containing protein [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MSDTTLPTPKPRIEIRYCTLCRWMLRAAWLAQELLSTFDSDLGEVALVPASKGEFRILVDGVLVWDRVADDGFPEAKEIK
    QRVRDVIAPERDLGHADRKSAAE

    >gi|117620194|ref|YP_856213.1| thioredoxin [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MVRVSARVQELKRICWLIVAGLLTACSPAPPFTDSQNQPVALTDFAGKPLLVNYFAPWCAPCLREIPLLEALTHEGQITV
    VMVNYDPATPAELAKLAGQYHIKVPLLIARQEASLPFPHPAGLPTSYLLDGEGKLQQTLVGEFTPSRLEALRASVKPIGR


    >gi|117619418|ref|YP_856214.1| arsenate reductase [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MSETQIYHNPRCSKSRETLALLEQHGIAPDVVLYLEQAPSEAEIRTLLSQLGFSDPRQLMRTKEELYKELGLGEVSGDDL
    IRAMHQHPKLIERPIVIKNGQARIGRPPEQVLEILK

    >gi|117618080|ref|YP_856227.1| NADH dehydrogenase [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MKRILIVGGVAGGASAAARARRLSEEAEIVMFERGEFVSFANCGLPYHIGGDIPNRDALLLQTPQSFKRRFNVDVRVFHD
    VIEIDKAGKSLLVRNLLTGEERREAYDVLLLSPGAAPIRPPFPGIDSPGVHTLRNIPDMDRILAALAHDQPRHVTVVGGG
    FIGLEMMEALHQRQLDVTLLELSDQVMAPVDKEMANMLHARIREEGIDLRLRTGLSAIESLDVLAEKIAAVATEQRSGLR
    LTLSDGSRLDTGLLILAIGVKPETLLAAKAGLERGPRGGIKVDAGMRTSDPFIYAVGDAVEETDFVTGESVLIPLAGPAN
    RQGRIAADNMLGRAETYKKTQGTAICKLFDLAVASTGLNEKRLLQLGLPFEKAYVHPGSHAGYYPGAHPVSLKLLFAPDG
    KIYGAQAIGKDGVDKRIDVLAVAQRAGLTVIDLQDLELTYAPPFGSAKDVINMAGFVASNHLKGDTLLCHAAEVEARHPH
    QQVLDVRNGPELDKLGRIPGAMHIPLDELRGRLHELPKDKELLIS
    CQVGLRGHVACRLLSQHGFKVKNLSGGFKTWQMAV
    ME

    >gi|117621520|ref|YP_856263.1| arsenate reductase [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MNDAHITIYHNPACGTSRNTLALIRNSGVEPTVIHYLDTPPSRDTLLALIAAMGMPVRNLLRQNVPPYEALGLAENQFSD
    DELVDAMLAHPILINRPIVVTPLGTKLCRPSEVVLEILPSPQQGAFSKEDGEQVVDAQGRRIG

    >gi|117619232|ref|YP_856267.1| alkyl hydroperoxide reductase subunit F [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MLDTNLKQQLNTYLQYIVNPIEISVSGNDSDKSAELLALAGEIAEMSPKITQTSGTNARKPSMSVAPKGQAPRVHFAGIP
    MGHEFTSLVLALLQSGGHPSKADAAVQEQIRNLKGEFHFETYISLS
    CHNCPDVVQALNLMATLNPGITHTMIDGALFQDE
    VNERQIMAVPNVYLNGQPFSQGRISLEEIVAKLDTGAAERKAQELSEKAPYDVLVVGGGPAGAAAAIYAARKGIRTAIVA
    ERFGGQVMDTVGIENFISVPYTEGPKLAASLEQHVKQYGVEVITEQRAAAISKDGYVNVDLASGATLKSRAVILATGARW
    RDLNVPGELEYRTKGVAY
    CPHCDGPFFKGKRVAVIGGGNSGIEAAIDLAGIVEHVTVVEFADTLRADEVLQKKARSMGNI
    DIIMSARTTEVIGDGSKVVGMDYEDRTTGEIKHLAVAGIFVQIGLVPNTEFLKGSDVALTRFGEIEIDTKGATSLPGVYA
    AGDATTVPFKQIIISMGAGATAALGAFDYLIRNPAPEATKADAVTA

    >gi|117618506|ref|YP_856268.1| alkyl hydroperoxide reductase subunit C [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MSTYINTEIKPFNATAYHNGKFVQVSDADLKGKWSVVFFYPADFTFVCPTELGDLADNYAEFQKLGVEIYSVSTDTHFTH
    KAWHDTSDTIQKIQYPMIGDPTGTITRNFGVMIEEAGLADRGTFVIDPQGIIQIVEINAGGIGRDALELLRKVKAAQYVA
    AHPGEVCPAKWKEGDATLAPSLDLVGKI

    >gi|117617718|ref|YP_856275.1| rhodanese domain-containing protein [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MQHNPRFLALVEAIRPHVRETDVHQIKRWQDEGRTFHLVDVREESEWARGHLPGATYLGRGVIERDIETRYPDPDTELYL
    Y
    CGGGFRSILVAENLQKMGYGRVVSVDGGFRGWCDAGYPVES

    >gi|117620083|ref|YP_856285.1| iron-sulfur cluster assembly protein IscA [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MAITMTDAAAARVSSFLTNRGKGIGLRLGVKTTGCSGLAYVLEFVDELADEDQVFEQDGVKIIVDAKSLIHLDGTELDFV
    KEGLNEGFQFNNPNAKGECGCGESFSV

    >gi|117618917|ref|YP_856394.1| thioredoxin-disulfide reductase [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MGSAHWQTRLQTPFPTSSIGMRATPGCGAFRDRACFQPFLTPLPPRQPIDAIDSLAFDPLSRITYNRANSSRLGNHIMSQ
    VTHSKLLILGSGPAGYTAAVYAARANLNPLLITGMQQGGQLTTTTEVENWPGDPEGLTGPALMERMKEHAEKFDTRILFD
    HINEVQLTQRPFRLKGDNGEYTCDALIIATGASAKYLGLPSEEAFKGRGVSA
    CATCDGFFYRNQEVAVVGGGNTAVEEAL
    YLANIAKKVHLIHRRDEFRAEKILIKRLHDKVASGNIVLHTHQTLDEVLGDDMGVTGVRLRNTQNDTTTDLPLMGVFIAI
    GHQPNTQIFAGQLDMQNGYLKVRGGLDGFATQTSIEGVFAAGDVADHTYRQAITSAGTGCMAALDAERYLDAQ

    >gi|117620235|ref|YP_856524.1| ada regulatory protein [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MSDYARIADAIRFIASQVARQPTLDEIAAHVHLSPFHFQRLFSRWAGVTPKRYLQVLTLERAKALLQESRPLLEVADTLG
    LSSGSRLYDHFVQLEAVTPGEYKQRGAGLVIDHGVHDTPFGQAFVALTPRGVCNFSFLDDQNPQAPLAALAHSWPEAELR
    EAPSRTRGVIHTMFDTSKAQDRPISLHVSGTNFQISVWRALLQIPPAKVVSYAQVASAVGNHKAARAVGLAVGANPVALM
    IP
    CHRVIQQNGKLGGYHWGETRKQAIHAWEAARYE

    >gi|117620533|ref|YP_856748.1| selenide, water dikinase [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MSSIRLTQYSHGAGCGCKISPKVLDTILKSQIPGFDDPTLVVGNSSKDDAAVVDIGNGQGIVSTTDFFMPIVDDPFTFGR
    IAATNAISDIYAMGGKPIVAIAILGWPINTLAPEVAQQVIDGGRQVCHEAGISLAGGHSIDAPEPIFGLAVTGIVPLDAI
    KQNDTAKVGDTLYLTKPLGIGILTTAQKKGKLKPEHEQLAPNAMCTLNKIGQRFAELPGVHAMTDVTGFGLAGHLLEMCE
    GSGVSARLDFKALPLLDEVDYYLSEGCVPGGTLRNFDSYGDKLDAMDDRTRNILCDPQTSGGLLVAVGKESEAELLAIAA
    QAGLTLSPIGQLQARTGNQFIEVVQ

    >gi|117619681|ref|YP_856823.1| copper-translocating P-type ATPase [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MSGCFHCGEPVPAGSRYALEIKGIVQPMCCPGCQAVAETILECGLASYYEHRTAPGTKGELVPAELAALTHYDLAEVQQD
    FVTDSATGSHKVREIQLTVEGLT
    CAACAWLIERHLGNLAGLHYINVNTTTHRARIKWDPDRLSLSDILKGFAKIGYRAYP
    FQTHQQEALYAREVRSYMFRLALAGLGSMQVMMCAVALYMDLFISVEEEFMVYFKWISLLLSTPIMIYSAQPFYVGAWRS
    LRQGHLSMDVSVSLALIGAFIASMWATVFNTGEVYYDSITMFVFFLLLGRFLELRARRKASESSSNLARLVPIMATRLDE
    DGEHEVAAKTLQVGDRVRVLAGATLPADGIILLGQASLNESMLTGEQLPLLKQAGDAVYAGTINTDAPLEIRVSHRIEES
    RLAQIMRLQDHALDDKPAIAQMADVLSRHFILVLLFIAAGVWTFWHFHQPEQAFWVTLAVLVATCPCALSLATPTALTSA
    TARLTRAGILLRRGHVLDVLTRANRIVMDKTGTLTTGNISLTSTEALGSLDETRCLAIARALEAYSEHPIARAFRSNTAE
    DAVLLAASKVTPVIGHGIEGVIDGRHYRLGSARWLGISDTHAAQADGLVIYLADEDRALARFLLSDTLRPDAKALIQAFK
    AAGLKTTILTGDSSAQADEVARELGVDELVKGVTPDGKLAYLKEHEARGDISIMVGDGINDAPVLAGAHASFAMAGGTDL
    AKNSADAILLADDLSRLLDARALALRTRKIIKENFAWSIGYNLLVLPLAASGWLPPYVAAAGMSLSSLIVVTNSMRLNR

    >gi|117620130|ref|YP_856831.1| glutathione S-transferase [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MSDLTLYLAPGTCAMAVRIALTEAGAPHRIKQMDLAAGEQRSPAYLAINPKGRVPALVTERGVLTETPALLLYVAQRFPD
    AGLAPLDDPFLLARMQEVHGFLAATVHVAHAHGRRGSRWADDPQAIAAMQAKVPHNMREGFAEIERHYLAGPWVLGERFS
    LTDIYLFVVASWLEGDGVAISEFPKVADHYRRMLARPGVQQGLAL

    >gi|117618617|ref|YP_856921.1| peroxiredoxin HYR1 [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MSLPDLILQRLDGTELPLSTLQGQVMLVVNVASRCGFTPQYTGLEALYRELGPRGLVILGFPCDQFGHQEPGDAEEIARF
    CSLDYPVSFPIMAKCEVNGEQAHPFYQWLKKEKPGLLGLENVKWNFTKFLIDRDGEVVDRFAPTTKPESLRDDILALL

    >gi|117621303|ref|YP_856944.1| thioredoxin 2 [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MSFITTYCSHCFTRNRLPEEKVDSNAKCGRCKSGLFATTPVNGQEQQFDTLIQSDIPVVVDFWASWCGPCLQFSPVFQQV
    ASGLEPRLRFVKVDTEQQAAIAARYAIRSIPTLMVFKQGKMLAQRSGSLPPSLFKEWLHSFI

    >gi|117618780|ref|YP_856960.1| disulfide bond formation protein B [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MIEFLRRIAAHRLAWSLLAASALFLELSALFFQHVLGLHPCVMCVYERIATLGVLTAGLLGMVAPQKWYVRWSALLLWGS
    SAFWGLKLALKHVDYQVNPSPFNV
    CEGFVDFPSWAPLDQWIPWMFYPDGDCSEVTWQFLSFSMPQWLVAIFAVYLLVFVV
    VAIGNLVKGRCCS

    >gi|117620509|ref|YP_856983.1| thiol:disulfide interchange protein DsbE [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MNARLRLFVPLVLTLGLGALLWLGLGNNPYSQDEAVAGRTLPAWQSDDLLGGAPIHTAALKGEPFVLNVWASWCPNCRAE
    HPLLGELASAVPLYGLNYRDKGDAARAWLTEAGNPYRAVLADPDGRLALELGVYGTPETYLFAGDGTLLTRHTGLLTREI
    WQRQFAPLLAKARSNIASQPEVEREVEREVKRQVQESKP

    >gi|117620254|ref|YP_857057.1| hypothetical protein AHA_2547 [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MTRRLSGAAFSTSSLLVSFSDNRVMSDNNTQHIAVLGAGPAGLMAAWRLRQAGFAVTLFEQESVVGGMCATQTFKGRDGE
    YRFDYGGHRFITKNPELLAFIDELMGDDLLHAERKSVIRFGGRTYDYPLNLPNLLKTAPLALMAGAVKDLLLLPFAKKPT
    DFAKASFAEWIQSHFGRTLYRQFFEGYTAKLWGINPDKLSADWAGQRISLIDLKDVARRLLPRRNGSMSVRTYARKYRYP
    KYGFGQIFTTLGERLVAEGVLLKTGATITRLDQTDGRIERVYWSQDNVEQSAAFDQVISTLPLPLTCQHLGLPCDLHYRS
    LRFVNMPLKQENLSDNTWQYLSDPHILATRLQEPRRRSPFMAPMGQTSVMLEIPCNPGDATWQAPLSDLRGRVTADLASL
    GVDTQKLGDETFEARSEYAYPLMDLGYQARRNEAIKALMPITNLIMTGRQGTFRYIFTDTAMEMGMMAADMVIDGVDRRH
    AIFNHRNENTVIETQSVA

    >gi|117619964|ref|YP_857078.1| methionine-S-sulfoxide reductase [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MEQIISPADALPGRREAMVIGQQHAVNGHPTQGPWPEGMAVAWFGMGCFWGVERLFWQQTGVYSTAAGYQGGVTQNPTYK
    EVCSGLTGHAETVQVVFDPKVISYGDLLKLFWEQHDPAQGMRQGGDIGTQYRSVIFFGDDTQEAIAQQSLAAYQQAMTAS
    GDGRTITTRILPLAPFYYAEDYHQQYLEKNPDGYCGLGGIGVCLPPSLNR

    >gi|117618781|ref|YP_857134.1| glutaredoxin 1 [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MFAVIFGRPGCPYCVRAKQIAEQLVEQRDDFKFRYVDIHAEGITKEDLAKSAGKPVNTVPQIFLDEQHIGGCTDFEAYAK
    ENLGLYQ

    >gi|117618025|ref|YP_857143.1| electron transport complex, RnfABCDGE type, A subunit [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MTEYLLLLVGTVLINNFVLVKFLGLCPFMGVSGKLETAIGMGLATTFVMTLASACSYLMEHYILIPLNIAYLRTLAFILV
    IAVVVQFTEMVIRKSSPTLYRLLGIFLPLITTN
    CAVLGVALLSINEHHNFIQSIIYGFGAATGFSLVLILFAAMRERLVA
    ADVPTPFRGVSIAMITAGLMSLAFMGFTGLIKI

    >gi|117618384|ref|YP_857148.1| electron transport complex, RnfABCDGE type, E subunit [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MIDGQSPLSESNGRREELKELMLQGLWKNNPSLVQVLGLCPTLAVSSTFTNALGLGLATMAVLVSSNLAISLVRNLVPKD
    IRIPVYVMIIAALVTSVQLLMNAYTYGLYQALGIFIALIVTN
    CVIIGRAEAYASKNPPLLAALDGFMMGLGFTLVLLVLG
    GLREIIGMGTLFDGADLLLGEWAKSLRIELFHADASLLLAILPPGGFIGLGLMIAGKNAINDWMGRKQSAEKAHCSVPAA
    GARATQL

    >gi|117617977|ref|YP_857476.1| YeeE/YedE [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MESQWLLSLGGGMLVGLAALILMLFNGRVAGISGILAGALQHRAPWRLLFLLGLGAGAWLALSLGWASMPAFSTLPGWPL
    VLLAGLLVGIGTRLGNG
    CTSGHGICGMGRLSLRSIVATLTFMAAGFITVFLTHHVL

    >gi|117617606|ref|YP_857757.1| Na(+)-translocating NADH-quinone reductase subunit E [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MDYYVNLFIHSIFVENLALAFFLGMCTFLAVSKNINTAFGLGMTVLVVMVIAIPLNNLIYRHILRPESTFLGEFDLSFLD
    FIVYIGVLAALVQVMEMVLDKHFPALYHALGIYLPLLTVH
    CAIFGGVMFMAQRDYDFIESVVYGAGSGLGWLLAIVAIAG
    LRQKMKYSDVPEGLRGIGITFIVAGLMSLGFMSFSGISL

    >gi|117618011|ref|YP_857762.1| thiol:disulfide interchange protein DsbC [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MKYLLLGMMLLGSFAASAGMDPQQLKQTIEQRLGVQVYLVDETPMPGLYMLGTAQGLLYTDARGDYVLQGTMLDLAHDMK
    NLTMLGLRQQRQLALAQIGERRVQLRAEQERHRVTLFTDLA
    CSSCRTTLAELPVLQARGVSVQLLPVLGTFADLAEAQAR
    WCDPRQFDALDLSDRLPETGCNEILAHHIGLSQWLGIKALPSWVLPNGDLVRGYQSPEQLLKILDHINAPANPSSSAS

    >gi|117618558|ref|YP_857787.1| DsrE/DsrF-like family protein [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MNQEIVIIANGAPYGSESLFNALRLAIALREQGGANLKLFLMSDAVSAALAGQAPAEGYNLRQMLEILLAQGISIRLCKT
    CTDARGITALPLIEGIEIGTLPLLAQWTLAADKVLTF

    >gi|117620305|ref|YP_857942.1| carboxymuconolactone decarboxylase family protein [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MTVICVFKVLNDSHLDAILASSSRQGPVLPNRRVKMQDWDQYRKQLMGRVMELGTLSPDTLKGYQQLSAAGSKSGVLDGK
    TRELISLAVAVTTRCDG
    CIAVHADAALKQGASRAEIADALGVAVAMNAGAAMVYSARVLDAIDR

    >gi|117621403|ref|YP_857953.1| putative thiosulfate sulfurtransferase [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MKRIMSLLRATLATLLLWHALPTLAAELPPLSLADANAKQAVILDTRASYFYQGWPMEGEQQGGHVVGAENLSAEWKYSD
    EEWPAALATKGLKADRPVALYGAPREVAEVARLLRQQGIKQLFELQGWKTAPREHLARWQQLVYPRWLADLQEGKPVVAA
    PKGDWKLFEVAWGSPKAYLLSHIPGAGYIDTNRLEEEPLWNKVSDEALKALLLENGIRHDTTVILYGRNTMAAARAAHLM
    MYAGVQDVRLLDGGLDAWFVQHLRTETGLANKFTPAKEFGVAIPVHPEYYTTLSQAKELLKQPDGALVSVRTWDEFVGNT
    SGYSYIKPKGDIPGAKWGRGGVDANSMSDFHNPDGTMKPAREILAMWDEWNIEPTQQAAFY
    CGTGWRASEAFFYAWLMDW
    KRISVYDGGWYEWSADPKNPIVTGERKPAK

    >gi|117620034|ref|YP_857987.1| iron-sulfur cluster insertion protein ErpA [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MDNFAVSMFVDLTVVRSVMSAVAEAPLPIQMTDAAANKVKTLITEEENPELKLRVYITGGGCSGFQYGFTFDEKINEGDT
    VVEKSGVTMVIDPMSLQYLVGGSVDYTEGLEGSRFTVTNPNATTTCGCGSSFSI

    >gi|117619895|ref|YP_858010.1| hypothetical protein AHA_3540 [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MMRLQSRTLMASLIAASFALSGCGDNQFEQETKLEQAAVQLSQETQQGGYQLLTVAELKTRMDKGEALVIIDTMPFEDSY
    KKEHIQGAKNFAFVKEAKSGDDWSQIVEGSGTPEQLLALLGDDKTRPVVFYCGFVK
    CGRSHNGAAWAVTQGYQQVYRVPG
    GIFAWKGAGYPVTAE

    >gi|117619580|ref|YP_858080.1| organic hydroperoxide reductase [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MHTNKIRDPDMKTLYRTQAIAQAGRNGEVHTLDNSLQLALALPTALGGNGKGNNPEQLLAAGYAACFSNALIHVAHKLGA
    PLSSAPVTAGVELLALDDGRFNFAITLDVALATTQPEQAAQAEQIVRLAHQT
    CPFSNAMRGNVVTRLLLNGAPLDETA

    >gi|117620213|ref|YP_858084.1| methionine-R-sulfoxide reductase [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MSGNTPNPEQWRRQLSAEQYHVCWEKGTERPYSGALLHNRKSGDYLCVCCKQVLFHSDAKFDSGCGWPSFDRAIEGTVTY
    TEDGSHGMKRVEITCSQCGSHLGHVFPDGPTETGQRY
    CVNSLSLDFDPES

    >gi|117619399|ref|YP_858190.1| membrane protein, suppressor for copper-sensitivity B [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MSGGNEFSRAFLSLLSFIFCETTSMSTLFKASLLLGCLLWQSSGLASDTGWLTSPQNDHAKVRLQADRSAPDHTRILLEV
    ALESGWKTYWRSPGEGGIAPQILWDQPVGDFQWHWPTPRPFEVAGLSTQGYQQQVRFPLSLDYPAGQPLKGTLRLSTCSN
    VCILTDYPFTLAVDGQTPAGFDFGWAQTMSTLPQTLPADTRVELGYQHNQLQLRAERAEGWQAPALFIDALEGAEFGKPA
    LEVSGNTLIARVPVSDGWQGDAPDLRGQPLSLLLGSGDEAWQTRATIADPLALPAPGQPLIWLLGAALLGGLILNLMPCV
    LPVLALKLGTVLQQQESEQRQVRKQFLAASAGIIASFWVLAAMSSLLRATQGAVGWGIQFQSAGFIGFMVAVTLLFCANL
    LGLFEIRLPSNLSTRLATSGGKGLGGHFLQGSFATLLATPCSAPFLGTAVAFALAAPLGQLWLIFTALGLGMSLPWLLVA
    ALPRLALWLPKPGRWMGRLRILLGLMMLGSSLWLASLLGNHLGSTATGWLMAAMLLVLLIGILWRYGMRGFTLALSLSAL
    IGGALLLGGALTAQGSGSVDRIAWQPLSEQAIVDALAQRKRVFIDVTADW
    CVTCKANKYNVLLRDEVQSALSAPDVVALR
    GDWSRPSDAISAFLRQRGAAAVPFNQIYGPGLPEGEILSPLLDKADLLDVLHQAGLVQADAPHF

    >gi|117618988|ref|YP_858191.1| secreted protein, suppressor for copper-sensitivity C [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MTLRTLKLRTLTLCTALVAGTLCAPLLHAAPFTPEQEARIKELIRETLVANPKILDEAAESWEKQNAAAQEAQLGDFIKG
    NQDVLFNSATSPRLGAKDPKLTLVLFTDYN
    CPYCKQFDPQLTKLLKAYPDDLGLVIKLLPFKGQSSAKAAQYSLTLWQQE
    PARFLALHDKLMSKQGMLTEADINKALAATGNTALKPDAKATEELRNSLRIGTLLGVQGTPATLIGNQLVPGAVPYDELE
    QLVKAELAKRA

    >gi|117617795|ref|YP_858193.1| suppressor for copper-sensitivity D [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MALVISTLLDLWRGPTLPAGAMEAPFTLQDGTTTSLAEQSRGKPLLVYYWASWCGVCRFTTPTVEQLWQQGENVLTVALR
    SGSDDQLRAGMAKKGLAFPTHNDERGDLAARWQVGVTPTFLIIKDGKLVSSTTGWSSWLGLKARLLWASLR

    >gi|117620513|ref|YP_858224.1| hypothetical protein AHA_3776 [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MSHVLSSGWASAEQARLFFEAQLAFRTDPADLAADLLAGEERIVVIDTRSAGHYAEGHIPGAISFPHATMNPATTAALAR
    DKVYVCY
    CDGIGCNGSTRGACKLAALGFQVKELIGGLHWWRQDGFAVATGSEPGVLQTGGIACGC

    >gi|117620395|ref|YP_858270.1| mercuric reductase (Hg(II) reductase) [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MTIELTVSGMSCGGCAASLQKALLAQPAVSTASVDFASSKAVIESELSKAELIALIEAKGFSAS

    >gi|117617915|ref|YP_858300.1| dihydrolipoamide dehydrogenase [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MSKEIKTQVVVLGAGPAGYSAAFRAADLGLDTIIVERYSTLGGVCLNVGCIPSKALLHVAKVIEEAKALAEHGIVFGAPQ
    TDIDKIRLWKEKVINQLTGGLAGMAKMRKVQVVNGFGKFTGPNTLEVTGEDGKTTVTFDNAIIAAGSRPVKLPFIPHDDP
    RVWDSTDALELTTVPGKLLVIGGGIIGLEMGTVYSSLGSEIDVVEFADQLVPAADKDIVKIYTKRVAKKFNIMLETKVTA
    VEAREDGLYVSYEGKHAPAEPVRYDNVLVAVGRVPNGKMLDAEKAGVAVTERGFIEVDKQLRTNVAHIHAIGDIVGQPML
    AHKGVHEGHVAAEVIAGKKHYFDPKVIPSIAYTEPEMAWVGLTEKEAKQQGLNFEVATFPWAASGRAIASDCSDGMTKLI
    FDKESGRVIGGAIVGTNGGELLGEIGLAIEMGADAEDIALTIHAHPTLHESVGLAAEVFEGSITDLPNAKAKKKK

    >gi|117620404|ref|YP_858452.1| intracellular sulfur oxidation protein DsrE [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MSLNFALLVTGPAYGTQSASTAYRFALSLIEQGYRLSHLFFYQDGVCNGNGLHAPASDESNLVALWRELANQQGIRIDVC
    VAAAMRRGVLDEQEAKGLGRAHFNLEPPFCLSGLGQLAEASLTADRFVQF

    >gi|117619922|ref|YP_858470.1| alkylhydroperoxidase [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MSRIHPVSQPKPAAAPTFAALKSSLGKVPNLYATLAHSPVVLNGLLGFADALGKGRLSARQRELLALAIGQANACQYCLS
    AHTLLAGRAGFDDDAIRAARLVQAADPLDHALLQLAVALVTQRGVISDQQLAAARAAGVDDELAMEVLGQVVINTLTNYG
    NHLAATDIDFPPVTLTP

    >gi|117617887|ref|YP_858500.1| coenzyme A disulfide reductase [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MRIVIIGGEAAGMSAAAKARRLAKEADIVVYEASEVISFGACGLPYFVGDEFQEPGYMAEFTPEQFAAKGIEVKTGHRVL
    GLDAAAQTLTVEHKGDIFTDRYDRLMIATGAREVMPPIPGLQQEGVFGLRRMADGLALKAAVQDKANSRALVIGSGFIGL
    EVVEALVHQGKEVRLIELAERVIPDAFDGEITQHIETELREQGVSLHLGERVEALLGEGRVTGVRTSHGEYEADIVVVCT
    GVKPNTEFLADTGIERLGNGAIKVDRQGRSSLANVWSAGDCASVWHGVKQQQVYVPLATIANKLGRMVGENLAGAEQEFP
    GTLGSAALKVLGLEAGRTGLSEQEAKAMGIDYRTVVIKDKCHTNYCPGQSDIHVKLVYEAGSKRLLGGQILGRKGAVHRI
    DALAVAITMGVTTEQLGMLDFAYAPPFSRTWDVLNVAGNVAK

    >gi|117620918|ref|YP_858551.1| YdiU family protein [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MKLINTFATELPWACEPVAPQPLHAPALLHLNCALLGELGLVAVSEADWLACCGHGQPLPGMQPVAQVYAGHQFGGYSPR
    LGDGRALLLGEQQAPDGSRWDLHLKGAGKTPFSRFGDGRAVLRSSIREYLASEALHALGIPTTRALVLVGSQEPVYREQV
    ETGATVLRTAPSHLRFGHVEYFAWSGQGERIPALIDYLLRHHFPELADGAELFAEVVRRTARLIAKWQAAGFCHGVMNTD
    NMSLLGLTLDYGPYGFIDAYVPDFVCNHSDPGGRYALDQQPAVGYWNLQKLAQALAGHVDGDALAEALAQYEHQLMLHYS
    ELMRAKLGLAVWEEDDPVLFRELFQLLAAHGVDYHLFLRRLGEVTREGAWPASLLALLPEPAAWQGWLEAYRARLAREGS
    EDGVRKGLMDAVNPKYVLRNALAQRVIEAAEQGDMAPFERLFTALQHPYDEQPEYEELATPQPAWYCGGELS
    CSS

    >gi|117618947|ref|YP_858639.1| thiol:disulfide interchange protein DsbA [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MKKVLFFLAAMLMIPMVHAAPEFKEGVNYDVVKQTGSAQPEVLEFFSYYCPHCAKFEPIAEDLKKNLPEGVPMKKNPVAF
    LGREMGPEMQRAYAVASLLNVEGKLTPAIFDKIHTQRQYPQSRADVKQIFVDNGVPAEEFDGAVDSFAVSGMVSQFDRNT
    ESYNIRGVPAFLVNGKYMVKIESITSQEQFNQLVKFLLAKKD

    >gi|117620940|ref|YP_858645.1| copper-exporting ATPase [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MTTHLQSPIHLQLPLSGMSCANCAGRITTALNKLDGVQATVNFALEQAAIDLASPDRLPAVLESIKAQGYDYGSETILFQ
    ITGMT
    CAGCSARLNKMLAALPGVISADVNFSIEQARIVLVPGMQTPAGLREQIEALGFGAQLAQGSASGRRQQLLEREAQ
    EAASARQAQTRVIVSALLTLPLLAGMLAMAGLLPWHLPAWLELVLATPVQFWIGARFYRGAWLAIKNRSANMDVLVATGT
    SAAYFYSLYLLLTLGMAASGQLYFEASAIIITLISLGKLLEARARRSTQSAIRELMALRPETATVWRGESWQSVAIDEVL
    RGDRLRVLVGERVPVDGRIVSGASELDESILTGESLPVPRGEGDKVLGGAINRSGVLEIEATTVGEDSSLSKIIALVENA
    QMGKAPLQQLVDKVSAVFVPVVMAIALFTLLVWYAISNDFGQALLAAVAVLVIACPCALGLATPAAIVTGTGVAARHGIL
    IKDVDTLQKAHAIKALIFDKTGTLTQGRPVLASWSGNDEQLRLAAALQQASEHPLALAMREAVGKEATLPQPEAVEVRVG
    AGIVGQVAGHRVAIGNGSLLAQLGIEPPQQDEQAADGATRVWVAIDGVVAGIAALADTLRPESPDAIATLRQRGIASWLV
    SGDAPAPVAHIAAKLGLDGAFDSVLPAGKVEKVEALRAQTSGLVAMVGDGVNDAPALAAADVGIAMGSGSDVAMETASIT
    LMRSDPRLVADAIDISAATWRTIQQNLFWAFVFNIIGIPLAALGYLSPELAGAAMALSSITVLSNSLLLKRWQPRALAHV
    STESNR

    >gi|117619589|ref|YP_855227.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
    MNILLANPRGFCAGVDRAISIVESALEKFGAPIYVRHEVVHNRYVVNKLKEAGAVFVEELDEVPDDSIVIFSAHGVSKAV
    REMAKSRALKVFDAT
    CPLVTKVHMEVHRASRKGSEAVLIGHAGHPEVIGTMGQYENREGGMYLVETPEDVAKLKVKNPDD
    LCFVTQTTLSVDETSDVIDALRAHFPKIQGPRKDDICYATQNRQDAVREMAGLVDAMLVVGSRNSSNSNRLRELAEKVGA
    KAYLIDDASMIEADWLAGVEAIGVTAGASAPEVLVQSVITRLRELGGKVVAEHPGREENVVFEVPPELRIL