Chlorobium tepidum TLS uid57897

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|21672944|ref|NP_661009.1| PilB-related protein [Chlorobium tepidum TLS]
    MRRVTTLLVMMLTVLSACQASPKASPTKPGNAMSNNHPQNPYYSRTDTTRLDLPNEVWKKVLSPELYAVARLAETERAFT
    GKYWNYEGLGTYYCAACGNTLFRSDAKFASTCGWPSFFETVRPGSVAYREDTSFGMVRTEVLCGRCGAHLGHVFDDGPPP
    TGKRF
    CMNSICLDFEPDQPETAKPQ

    >gi|21673349|ref|NP_661414.1| hypothetical protein CT0514 [Chlorobium tepidum TLS]
    MAIATARAGGKETGTEQMYILQVTNSRSTMSKMSNVKEVNASTAFSMIKKGALLVDVRETREINRKAFGVSDYLSVPMSR
    FQSSLHEIPAERKVILA
    CHSGNRSSIASRILVNSGHRKVHNLQHGIISWEREGLPVRKKESPSPLTMLFQMFRKEA

    >gi|21673494|ref|NP_661559.1| bacterioferritin comigratory protein, thiol peroxidase, putative [Chlorobium tepidum TLS]
    MALLQAGQKAPEFTAKDQDGKEVSLRDYTGRKVVLYFYPKDDTPGCTKEACAFRDNLPNFEKVDAVVLGVSVDGQKAHRK
    FADKYELPFTLLVDDEKKIVEAYGVWGLKKFMGREYMGTNRVTYLIDEQGTIEKVWSKVKPETHTAEVLDWLQQKT

    >gi|21673584|ref|NP_661649.1| thiol peroxidase [Chlorobium tepidum TLS]
    MIMATITLKGNSIHTAGELPAVGSQLPAFTLVKSDLSEVSPADFAGKKLVLNIFPSLDTAVCAASVRRFNKEAGERGDAV
    VLCISADLPFAQGRFCTTEGLDNVVPLSVYRSPEFGLDYGLTITDGPLKGLLSRAVIVTDASGKVLYAEQVPEIVQEPDY
    DKALAALA

    >gi|21673615|ref|NP_661680.1| thioredoxin [Chlorobium tepidum TLS]
    MAQTLDDLIRTSELPVFIDFWADWCGPCKMVAPSVKQLASEFKGRLIVVKVNVDQQPDAAARFQVQGIPALMLFVGGQLK
    WRTAGAIPYQQMRQEVLKAIG

    >gi|21673644|ref|NP_661709.1| copper-transporting ATPase [Chlorobium tepidum TLS]
    MTTKTYSVKGMHCASCAAIITKKLSKVEGIEKADVNLATEKAQLEFTGEAVTDDALNELLGKYGYGLVSEQPPATPSAPF
    VDRKAAAEKAKMEKEMELQAQLAKVQLALPIALMVFILMMWDIAARSFPSMPGMPIPMALFNIVSMALATYMVFRIGAPF
    LHGIVMFVQSGAASMDTLIGIGTLTAYLYSTVITLMPEVRELLRVPNYTYFDTTIVVIGFVLLGKYLEARSKLKTGEAIE
    KLIGLQAKSAIVRRGGAEVEVPLEQVQKGDLIVVRPGTKVPVDGTITEGSSSIGESMVTGEPVPVDKTVGDPVIGGTINR
    QGAFVFTASRVGEETVLARIIAMVEEAQGSKAPIQNIADRIAAIFVPAVLVIAALTFILWLTVGSLFIDFSTALSFGIMG
    MVGILVIACPCALGLATPTAIIVGIGKGAEYGILIRNAQSLETLSTVDTVVFDKTGTITTGTPSVTDVLPFDDTVDPEKI
    LQLAASIENRSEHPLAQAILAAAKEKGIDLHEVTGFEALEGIGVKGTIDGKNISVRKPDSGDSSRSRIAELQQQGKTVVI
    LEEEGAPLGLVALSDTIKTEAADAVKALHAKGVKVIMLTGDNKLAANFMARQAGIDKVIAEVLPQEKADRVRELQQQGRK
    VAMAGDGINDAPALALADVGIAMATGTDIAIESAGVTILQGGIRKVAQSITLARATMRVIRQNLFWAFIYNVIGIPLAAG
    ALYPFFGIFLNPVFSGVAMAGSSVSVVTNSLRLKAKKL

    >gi|21673670|ref|NP_661735.1| thioredoxin [Chlorobium tepidum TLS]
    MSGKYFEATDQNFQAEILNSDKVALVDFWAAWCGPCMMLGPVIEELAGDYEGKAIIAKLNVDENPNTAGQYGIRSIPTML
    IIKGGKVVDQMVGALPKNMIAKKLDEHIG

    >gi|21673671|ref|NP_661736.1| thioredoxin reductase [Chlorobium tepidum TLS]
    MDKDIRDVVIIGTGPAGYTSAIYTGRANLKPLVIEGPQPGGQLMITTDIENFPGFPEGIPGPELMGRMREQAARFGVEFQ
    FGSITEVDVSRSPFSLMLDNGQEILARTLIIATGANAKWLGIESEEKYRGRGVSA
    CATCDGFFFRNCRVFVVGGGDTAME
    EALYLTKFASEVVLVHRREEFRASKIMSLRASKNEKITTMLNQVVDEILGDDMKVTGIRLKNVKTGELTEHACDGVFIAI
    GHEPNAKLFKGQLDMDDYGYILTKDHSTETSVKGVFACGDVQDFTYRQAVTAVGTGCMAAIEAERFLESIR

    >gi|21673672|ref|NP_661737.1| hypothetical protein CT0843 [Chlorobium tepidum TLS]
    MVRFIELVRHCLLDVREILPWDLVDRLKENPGLLILDVREPNEFDAMHIAGSLNVPRGILESACEWDFEETEPELVNARQ
    REIVVV
    CRSGHRSILASHSLQVLGYENVVSLKSGLRGWNDYEEPLVNKAGEVVDPDFADQYFTAKLRADQMRPKRAS

    >gi|21673684|ref|NP_661749.1| DsrE protein [Chlorobium tepidum TLS]
    MNIGILLKEGPYNHQAADTAYKFAEAAIAKGHKVDAIFLYNDGVINATKLGDPPQDDRNIAARWTELNQKHGVEVLACIA
    ASKRRGINDDVMIDGAEITGLGTLTDIAIRNDRLLTFGD

    >gi|21673695|ref|NP_661760.1| heterodisulfide reductase, subunit A [Chlorobium tepidum TLS]
    MSVETILVVGGGISGITTAVEAAEVGYNTVLVEKKPYLGGRAAQLNKYFPKLCPPYCGLEMNFRRIKPNPKITVYTMTEV
    ESVSGQEGNYSVRLKVSPRFVNEKCTACNACAEACPVERPNEFNFGMDKTKAAYLPHVLSYPMRYVIDRDACKDNSCDKC
    VKACKYNAIDLNMKPQTIEMKVGSIVYATGWNPYDATRMDNLGFGRVKNVITNMMMERLAAPNGPTGGKLLRPSDNKEVK
    KVVFVQCAGSRDENHLNYCSSICCMASLKQATYVRERIPDSQVVVAYIDLRAPGKYEEFLNKVEADANVKLVKGKVAKIE
    EDKATGGVILEFEDVEGGGKRHEHADMAVLATGMEPCVKANSMLSFEENGFINGGSAAGIYSTGVAKRPSDVTTAIQDAT
    GMALKSIQSLVRS

    >gi|21673777|ref|NP_661842.1| hypothetical protein CT0949 [Chlorobium tepidum TLS]
    MDSDLIVTFGGGKKVNAEFRGFTIKTDQSVHSGGEGSAPEPFALFLASIGTCAGIYVYSFCQSREIPTDGIRIVQSHEPK
    ADGRGIGKITLTIEVPPTFPEKYKDAVINAANLCAVKKHIMEPPAFEVKTKVVEG

    >gi|21673835|ref|NP_661900.1| hypothetical protein CT1007 [Chlorobium tepidum TLS]
    MLLFRKSFTILAFALTAIFSFGATLNAASPEPQAAAVQPATKGLFVVVTSDDPMTQMMAMVLSTQTLTQGRSVRVLVCGK
    AGELVLKGSKEKLFKPLDKSPQMMLKGLIAKGVTVEI
    CPLYLPDAGKQPSALIAGVTIAKPPVVAAAMAEDGIKLLTF

    >gi|21673842|ref|NP_661907.1| sulfide dehydrogenase, flavoprotein subunit [Chlorobium tepidum TLS]
    MGNTISRRTFNRLLISGLAGSSLLMSGGPLMASAPKAHVVVIGGGFGGATVARYLRQLDPSISVTLVEPKKVFHTCPMSN
    WVIGGLFSMQNTAHTYHALRSRYGVEVVQEMATGIDPVKKTVKLKGGRMLSYDRLVVSPGVDFIWDAIEGYSRDVAESSM
    PYAWEAGPQTLLLRRQLLGMKDGENVIICAPKNPFRCPAAPYERASLIAYYLKKSKPKSKVIILDDKEVFTKQDLFMLGW
    DRLYRGKIEWRSASAGGKVERLDPAKMTVATEFGDEKGGVINVIPPQKAGRIAVETGLADTSGWCPVNPANFESLQHPGI
    HVIGDAALVGTMPKSGTAANTQAKALAAWLVASFGGGNAGEHDLASLCYSLLAPGYAISVAGGYIQSPEGIKDNPDTVHL
    TSMEATTAQLAGEAEQALQWYHNISQDTWG

    >gi|21673850|ref|NP_661915.1| thioredoxin family thiol:disulfide interchange protein [Chlorobium tepidum TLS]
    MKSIKTFFATSFMALSMLGAVPVARTFAAGPSASPAVAGKMAPAFTLKTLEGKELNSSQLAGRPYIVNFFASWCPPCREE
    LPGMVALQKKYAKQGFTFVGIAFRDRPATLPDFLWEMGVEYPVGLTTPELEAAFGKFMPGGKIRVIPATFVVGRDGKLIN
    AVSGGLVKEDFESLILKAIGSRPSK

    >gi|21673898|ref|NP_661963.1| thiol:disulfide interchange protein DsbE, putative [Chlorobium tepidum TLS]
    MKRSTLSTCRVALFALVLSVGLSANAHALDKGDKAPDFALPGKTGVVKLSDKTGSVVYLDFWASWCGPCRQSFPWMNQMQ
    AKYKAKGFQVVAVNLDAKTGDAMKFLAQVPAEFTVAFDPKGQTPRLYGVKGMPTSFLIDRNGKVLLQHVGFRPADKEALE
    QQILAALGGN

    >gi|21673901|ref|NP_661966.1| thiol:disulfide interchange protein DsbD [Chlorobium tepidum TLS]
    MLFMRSASAMAADFLDPEQAFVPSAELTANRSIAVHWKIAKSYKLYRDQIKVGVSGGKASLGEPVFPEGILFTDPSTGEK
    QVIYHDELRLEVPVKQASAPFTVKVEYQGCAEDGLCYPPISKSFKVDPSRPGALAAVESTPDTGASTGLQPAASDAAPAV
    AASSANAVDNGGKNDLSLAQSTLESGSLWKVFAAFLLFGLLLSFTPCVLPMVPILSSIIVGEGETTKAKSFLMALAYCLG
    MALVYTSLGVAAGLAGEGLAGALQKPWVLVMFSLLLIGLSLSMFDVYQLQAPASLQNSLSKTSSKLKGGRFVGVFFMGAI
    SALIVGPCVAAPLAGTLVYISQTKDVVIGGLALFSMAMGMSVPLLLIGLSAGSLLPKAGAWMIGVKYVFGLMLIAVAIWM
    VTPVLPPQALMVAWGALGILCAVFAGVFGHLPEKLTVGGKFKKALGLVLFIIGVMELAGAASGGTNPLEPLAGLRGGSSV
    AAANNGKTAELAFKKIRTVEDLDRELHASAGKKPVMLDFYADW
    CVSCKEFEKFTFSNAKVQQGLADVTLLQVDVTANTAD
    DKALMKRFNLFGPPGIIFFDKSGNEQVDNRIVGFVEAEEFLKHLEKL

    >gi|21674040|ref|NP_662105.1| thioredoxin [Chlorobium tepidum TLS]
    MQSRIPFDFQNDVIERSKTVPVLVDFWAQWCGPCRILAPVLEKLAERHAGKWVLVKVNTEEFPEISAQYGIRSIPNVKLF
    SNGVVIDEFTGALPEYQIEQWLAKALPSPWAEEVARAAAEMAAGNDAVAITLLEGVLAKEPENRDAAAMLARLILFSRPE
    EALRLAETLEAEPDYADLSESVRTLGALLVRPASAFPDGEGREAYGEAVESLRKGDMDSALEHFISVLRTNRYYDDDGSR
    KACIAIFRFLGEEHEITMKYRRAFDRAF

    >gi|21674069|ref|NP_662134.1| heterodisulfide reductase, subunit A [Chlorobium tepidum TLS]
    MPETISTQGFRMAKIGVFVCHCGENIASKVDTGNLVKALSDHPGVEICNEYKYFCSDPGQETVKRAIRENNLTGVVVAAC
    SPRMHETTFRKACAEAGLNPYMLELANIREQCSWVHSDKDQATKKAIEITRSLVEKVKRNNELKPISVPITRRALVIGGG
    IAGIQAALDIAGAGREVILVEREPSIGGHMSQLSETFPTLDCSQ
    CILTPRMVEAIQHPNITVLTYSEVEEVDGYIGNFRV
    KVRKKARYVDIDKCTGCGDCIQKCPVKKIPSEFECGLGNRTAIYTPFAQAVPNVPVIDKNRCTYFKNGKCKICQKTCQIE
    NCIDFEMQDTFEEYEVGAIVVATGFQIQDTSVYGEYGYGKYKDVITGLSFERLASASGPTAGKILRPSDGKEPETVVFIQ
    CAGSRDPSKGVKYCSKICCMYTAKHAMLYAHKHHGSNSKIFYMDIRAAGKGYDEFTRRAIEEDEAEYLRGRVSKVFEENG
    KLIVRGVDTLLGKPVEVAADMVVLATAIVPQPDAKEFAKRIGIGYDEYGFYNEAHLKLRPVETATAGIYLCGACQSPKDI
    PDSVAQASAAAAKVLGLFNREQLEREPVVAAVGESTCAGCWGCVYACPYNAIEQKEIRDRNGNLIKEVASVNPGLCQGCG
    TCVTFCRSNSIDLAGFTEKQIFAEVMAL

    >gi|21674101|ref|NP_662166.1| bifunctional methionine sulfoxide reductase B/A protein [Chlorobium tepidum TLS]
    MKYKTLTPEEKRVIIDKGTERPFSGKYYLTKEKGVYQCKQCGADLFRSDAKFDSGTGWPSFDDAIPGAVRQETDRDGMRI
    EILCANCGGHLGHVFYNEGFTSKNARY
    CVNSVSLSFEPSDKPATATEKAVFAGGCFWGVEYHFKKMKGVLSTTVGYTGGK
    TAHPTYEQVCSGRTGHAEAIEVEFDPSVVSYEELAKLFFEIHDPTQVDRQGPDVGEQYRSAVFYQNDQQKKIAEALIEQL
    KKRGYDVVTSVEKGGEFWPAELYHQDYYEKTGHKPYCHIYQKRF

    >gi|21674102|ref|NP_662167.1| hypothetical protein CT1279 [Chlorobium tepidum TLS]
    MEKQPNKLIREKSPYLLQHAWNPVDWHPWGEEAFSRARETGRPIFLSSGYSTCHWCHVMEHESFENAETAALLNRHFVPV
    KLDREEHPDVDHLYMMFVQATTGRGGWPMSVWMTPDLKPFFGGSYFPATERWGMPSFRSVLEHLANLWEHDRPRLLASAG
    SIMDQLSGLTRPQEGTDEVTDAHASACLAALERGFDAEWGGFGGEPKFPRPAVLSFLFSHAVATGNRHALDMALLTLRKM
    AAGGIHDHLGVAGLGGGGFARYSTDRFWHVPHFEKMLYDNAQLAASYLEAYQASGDELFANTARDIFHYVLCDMTSPEGA
    FWSAEDADSLDPYGSGEKREGAFYLWTEQEITGLLDPEEATLFIATYGIRSDGNAPFDPHGEFTGKNILIRTMSDNELAG
    TFEIPIETVGKRLNSARKKLFEARKKRPRPGLDDKILTSWNGLMLSALAKGSLVLGDTTLLEAAERAARFILDTLCDSKS
    GKLLRRYRDGQAAIEGKAADYACLILGLLDLYSASFDSDWLRAAIKLAEAQIERFFDQEAGVFYSTAVEDHSVPLRMIED
    NDNAEPSANSVNALNYLRLAAITGRDEFRTIALRTIRHFSGTLDANPSALPLLLVARQIATASPVQIIFAGKRGNPALAK
    LVATAFRHNRPELTVIHADETCEALLPEAAAIGKMHKGEPAAYLCAGGSCQPAIRNAESLDAALGSFAFD

    >gi|21674112|ref|NP_662177.1| methylated-DNA-protein-cysteine methyltransferase [Chlorobium tepidum TLS]
    MQQESILTNYSSFSCRRMPVGLIGIRAHGGRVTDLLFMHVEPSTALSAPGSRLIDEAFQQLEAWFSGRLREFALPLVEPR
    SAFERRVREAMLAIPYGQTASYGELAAAIGSPGAARAVGAACGRNPLPVIVP
    CHRVLGAGGRIGGYRGGTEMKRWLLDFE
    RRNSG

    >gi|21674121|ref|NP_662186.1| dihydrolipoamide dehydrogenase [Chlorobium tepidum TLS]
    MQQADTLAAQFDVAVIGSGPGGYEAAIHAARYGLKTCIVEKAVLGGVCVNWGCIPTKALLRSAEVFDLAKNPETFGVNVG
    NVSFDLAQAVKRSRNVALKSSKGVAYLLKKAAVEVLAGEAVLTGGAGVMVTMPDGSVRMLGAKNIIVATGSTPRVIPGLE
    PDGKKIITSREALILKEVPKSMIVVGGGAIGVEMAWFYAKAGSKVTIVELMPRMLPAEEAEVSEALKRSFEKAGITVHCG
    AKLDNVAVSESGVSAELVVEGSAPQTLNASCLLVAVGVTGAIDGLGLDAVGVETERGFIRTDGQCRTSAPGIYAIGDVRG
    GMLLAHKASAEAAIAVEAIAGKSPEPLSEPLIPRCVYAQPSVASVGLTEEAAVNAGYQVAVGRSQFAASGKANAYGQLEG
    FVKLVFDAATGKMLGGHLIGHDAVELIGELGLACRYGVTAGGLVNTVHAHPTLSETVREAAFDALQSMG

    >gi|21674312|ref|NP_662377.1| thiolredoxin peroxidase [Chlorobium tepidum TLS]
    MSVLVGRPAPDFNAAAVVNGSTFVDSCQLSAYRGKYVVLFFYPLDFTFVCPTELHAFQEKLDEFKKRNVEVLGCSVDSKF
    SHFAWLNTPRSKGGIQGVTYPLISDINKTIAKDYDVLTPDGSVALRGLFLIDKEGIVRHQVVNDLGIGRNIDEVLRIVDA
    LQFTEEFGEVCPANWNKGDKTMKPTDEGLKEYFAE

    >gi|21674543|ref|NP_662608.1| glutaredoxin family protein [Chlorobium tepidum TLS]
    MKKIKILGTGCAKCNQLTDAVKAVIAAENIEAEVQKVEDMQQIVSYGVMSTPGLVVDGKVVCSGRIPSGDELREMLTAAP
    KPSCCCGDYANGTDRPNGTC

    >gi|161485727|ref|NP_662627.2| peroxiredoxin [Chlorobium tepidum TLS]
    MSQQVDDDLYYDISMPLLGDDFPELKVQTTHGPMNIPGDLKGSWFVLFSHPADFTPVCTTEFVAFQQRVEAFEKIGCKLI
    GMSVDQVFSHIKWVEWIKENLDVDITFPIVAANDRIANKLGMLHPGKGTNTVRAVFVGDPNGKVRLVLYYPQEIGRNMDE
    ILRAVKVLQISDSNKVAMPADWPNNLLIKDHVIIPPANNVEDAKKRKEQQYDCYDWWFCHKPLDK

    >gi|21674773|ref|NP_662838.1| dihydrolipoamide dehydrogenase [Chlorobium tepidum TLS]
    MSTKFDVIIIGGGPGGTPAAMQLASQGKTVLLVEESGKLGGACLFVGCIPSKIIRHWADEYAVKLKYSAQEALSPEDREA
    AWNEIMRKMQTILSQRSGAAMQMLKHLSNLRFVAGHAKFVSNNELVINEKDTGRKEKYTFNKAIIATGSHSFIPPFKGNG
    VQDVLTSEVLFSQDKLPESLLIIGGGPIGIELAQMLTKLGTKCTIIELLDSILYGVVETEFVSIISNQLSSLGVNIYTSS
    QVQEINKSDGHFDVTFTDANGSEHKENFEDVLVVTGKVPNIESLNLDSTDIKYDRKGIIVDEYLETSVKGIYATGDVTHG
    PKFAHTATYEAHIASANISAGNNQKVDFSKNTWVLFSEPEIVAAGFTEAQAVQEGYDIITGVYDYKIDAAAQVMNSPFGY
    LKYVVNKKNSEIIGVHICMNNASSLAGEASLIIANRLILKNVAETIHPHPTLTEAFGILAQKMLSKS

    >gi|21674812|ref|NP_662877.1| bacterioferritin comigratory protein, thiol peroxidase, putative [Chlorobium tepidum TLS]
    MIEEGKIAPDFTLPDSTGKMVSLSEFKGRKVLLIFYPGDDTPVCTAQLCDYRNNVAAFTSRGITVIGISGDSPESHKQFA
    EKHKLPFLLLSDQERTVAKAYDALGFLGMAQRAYVLIDEQGLVLLSYSDFLPVTYQPMKDLLARIDAS

    >gi|21674888|ref|NP_662953.1| NADH oxidase, putative [Chlorobium tepidum TLS]
    MNKQVDVLVIGGSAAGIVAATTGKAFYASKSFLIVRKEPEAVVPCGIPYIFGTLDGVHQNIVPTAPLANADVELLIDEVV
    SIDREAKSATTAGGVVISWDKLVLATGSEPKTPDWLEGRDLDGVFVIPKNRDYLCRLRSRLEEPRRVAIIGGGFIGVELA
    DELAKKGHDVTLVEILPHVLSMAFDSDLSLKAEELLVKRGVKLKTGEKLKKLAGQASVSKVILESGEEIEVDIVILATGY
    APNVELARSAGIKINELGAIRVDEYMRTEDKNIFAVGDCAEKFSFITRIVKGLMLASTACSEARIAGMNLFGLSRLRTFS
    GTIAIFSTAIGGTTFAAAGVTEQLARERGFEVVSAGFTGIDKHPGTLPETSNQYVKLIVNSENGLVLGGAVMGGQSAGEL
    INVIGVIIETKMTVNELLTLQFGTHPLLTGPPTAYALIKAAEAVEMKLRHFK

    >gi|21675042|ref|NP_663107.1| thiol:disulfide interchange protein, thioredoxin family protein [Chlorobium tepidum TLS]
    MKRLASPFAPFVAALMVFSLSLAFSAQADARPTPAPSFSGVTVDGKPFSSASLKGKAYIVNFFATWCPPCRSEIPDMVQV
    QKTWASRGFTFVGIAVNEQLPNVKNYMKTQGIIYPVMMATPELIRAFNGYIDGGITGIPTSFVIDASGNVSGVIVGPRSK
    ADFDRIVKMALGAKAATK

    >gi|21673076|ref|NP_661141.1| hypothetical protein CT0237 [Chlorobium tepidum TLS]
    MRPQVTIYGKPECCLCDDALKVLEAVRKRIPFDIEKRDISGNADLIERYGLSIPVIFVDGKLAFKHRIDKERLIALLKGQ