Chlorobium phaeovibrioides DSM 265 uid58129

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|145218831|ref|YP_001129540.1| sulfide dehydrogenase (flavocytochrome), flavoprotein subunit [Prosthecochloris vibrioformis DSM 265]
    MGQNISRRDFSKLLFTGAAGSALGIGAFPLRAGAAASKRVVVVGGGFGGASAAKYLKKLDSSISVTLIEPKAVFYTCPFS
    NWVIGGLKTMQEIAQKYAVLKNRYKVDVLADTVVSVDGVKSTVRLKSGKVVGYDRLIVSPGIDFDFDDIEGYSRKVAESV
    MPHAYEAGPQTVLLQKQLHSLKDGGKVIICPPANPFRCPPGPYERASLIAHYLKENKPKSRILILDAKEKFSKQGLFTKG
    WERLYPGMIEWRSASTGGRILNVDSSAMRVTTEFGIEKGDVINLIPPQKAGKIAFDAGLVDSSGWCPVNPVSFESLIQPG
    IHVIGDACTAGAMPKSGFAASSQGKVTAAAIARLFRGEVPVAPSLVNTCYSLIGPGYGVSVAAVYKLTADGIVSIKGAGG
    LTPMDADDDQLSEEATFARGWYNNIAQDIWG

    >gi|145218848|ref|YP_001129557.1| redoxin domain-containing protein [Prosthecochloris vibrioformis DSM 265]
    MFTMIRRTALLSLAALLIVSLYSPTLSAASPAASSLKVPAFSATALDGRTVSSANLAGKTYIVNFFASWCPPCRAEIPDM
    VELQKAYTSKGFTFVGIAVSDSEPSIRDFVRRSGISYPVVVDNGSVASAFSPLVSGGLRSIPTSFVVNASGRVTHVFAGA
    RSREAFKVMIDEALGKPKTAK

    >gi|145218856|ref|YP_001129565.1| rhodanese domain-containing protein [Prosthecochloris vibrioformis DSM 265]
    MPWDLVERLKENPELLLLDVREPAEFLAMHIPGSLHVARGVLEAACEWDFDDTCPELVRARDREIVVVCRSGHRSVFAAE
    VMQRMGYSRVLSLKTGLRGWNDYEEKLVDGSGRQVEAEEADSFFLSRVREEQKKPKE

    >gi|145218864|ref|YP_001129573.1| DsrE family protein [Prosthecochloris vibrioformis DSM 265]
    MNIGILLKEGPYNHQAADTAYKFAEAAIKKGHTVDAVFLYNDGVINATNLTDPPQDDRNIAARWSNMAKEHGVEILACIA
    ASKRRGITDDIMIEGGSITGLGTLTDIAIRNDRLLTFGD

    >gi|145218923|ref|YP_001129632.1| redox-active disulfide protein 2 [Prosthecochloris vibrioformis DSM 265]
    MIQVKILGTGCAKCNQLADAVKALIAADSIVAEVEKVEDIQKIMSYNVLSTPALVVDGEVRASGRVPSADELRSLLSPKA
    KGCCCKGSSGSSCC

    >gi|145218959|ref|YP_001129668.1| redoxin domain-containing protein [Prosthecochloris vibrioformis DSM 265]
    MSTPPMTILRKFTAAALLALSVGGLAPALPAVAAVSPAPASVAGKTAPAFTMKTLDGKEVTSAQLAGRPYIVNIFASWCP
    P
    CRQELPGMVDLQKKYEKQGFTFIGIAFRDRLSTLPDFLWEMGVEYPVCATTPELEAAFGQFLPGGSIRSIPVSFVVGRD
    GKLMNVVRGGLTKADFESLILKAINTKSAR

    >gi|145218966|ref|YP_001129675.1| sulfide dehydrogenase (flavocytochrome), flavoprotein subunit [Prosthecochloris vibrioformis DSM 265]
    MSGLPVMASGSRARVVVIGGGFGGATVAKYLKMGDPSLSVTLIEPKKVFHTCPMSNSVVGGLQSMSFIAQNYDALRNQYG
    VEVVQDFAAAVDPVSKTVSLKGGKSIGYDRLVLSPGVDFIWDSIPGYSEEVAESVMPHAYEAGPQTELLRRQLLALKDGE
    KVIIVAPKNPFRCPAAPYERASLIANYLKKNKPKSKIIILDEKEVFTKQDLFMLGWDRLYPRMIEWRSGAFGGKVESLNP
    SAMTVATEFGDEKAGVINVIPAQKAGRIAFAAGLVDESGWCPVDELTFESLKHPGIHVIGDSALVGPMPKSGVSANTQAK
    VLAASLIESFGGKPAEEHELSSLCYSLIGPGYAVSVAGAYTRNEQGISEKPDAVHLTSMDASSQQLAQEAVQSDQWYHAI
    THDIWH

    >gi|145219111|ref|YP_001129820.1| redoxin domain-containing protein [Prosthecochloris vibrioformis DSM 265]
    MIAEGTPAPDFTLPDSEGRMVGLSSFKGKKVLLVFYPGDDTPVCTAQLCDYRNNVTEFTKRSIAVLGISADSPESHKTFA
    AKNQLPFTLLSDSSKKTAEAYGALGFLGMAQRAYVLIDEEGKVLLAYSDFLPITYQPMKDLLLRIDRA

    >gi|145219374|ref|YP_001130083.1| glutamate synthase subunit beta [Prosthecochloris vibrioformis DSM 265]
    MGKVKGFMEFQREVPADRAPLERIKDWKEFHLKMSDEALQSQGARCMDCGTPFCHTGIMLGGMTTGCPIHNLIPEWNDDV
    YRGFWRDAYDRLMKTNNFPEFTGRVCPAPCEGSCVLGIIEPPVTIKNIECDIIEHAFAEGFVVPKKIEHRTGKRVAVVGS
    GPAGLACADQLNKAGHSVTVFERDDR
    CGGLLMYGIPNMKLDKQAVVQRRIDIMEEEGVVFMPNTEVGSSSCPAEKLLEDF
    DAAVLCTGSTVPRDLDAEGRRESGGIHFAMDFLRSSTKALLGDSQPVLSAEGKNVVVIGGGDTGTDCVATSLRQGCKSVV
    QLEIMPKPALERTGDNPWPQWPKTFKVDYGQEEAAVLQGEDPRRYSMMTRKFIADEGGNLKALQVSQVEWVKKDGRFIPQ
    PVAGSEESIPAELVLLAMGFAGPEAALAEQLGVACDERSNIKASEKQYLTSRKKVFAAGDARRGQSLVVWAIQEGRGAAR
    ECDRFLMGETSLP

    >gi|145219388|ref|YP_001130097.1| protein-disulfide reductase [Prosthecochloris vibrioformis DSM 265]
    MEKLEKAYFTCMKTFTSTGAGFRRILLPLLALLGLLVGAVSLRAADFLDPDSAFRLRASLETDGSVSLHWEIAEGYKLYR
    DQIRIVVEGGSAEIGVPELPEGIATVDSETGGPSVIYHDRLDVSVPFSAATGPFRLSVTHQGCSEEGLCYPPSTTKFTVD
    PAKPGSLAAVHQTGFFGINPEPTLPAEPAVASFQGEEGSLATATLMEGSFWKIALAFFVFGLLIAFTPCVLPMLPILSSI
    IAGEGESTRMRSFLLSLVYSGGMALVYTLLGIAAGLAGEGLAGFLQQPAVLAGFAALLVVLSLSMFDVYQLQVPSSMQNR
    LNAASGKLKGGRILGVFLMGAISALVIGPCVAAPLAGTLVYISQTKNVVIGGLALFSMAAGISVPLLLIGLSAGWLLPRA
    GAWMQGVKYVFGILLIAVAIWMVTPVLPAQVLLFLWGALAILSAVFLGVMSRLPEKPTTGSRFRHALGIVMLAIGILEIA
    GSLSGARNPLQPLSEIRPVSSSERKEIATLQFSPVRSSAELDSLLNSTTGPVMLDFYADW
    CVSCKELEHVTFGDPAVMKQ
    LGSMALLQADVTANSEDDRLLMKRFSVFGPPAIVFFDQAGTEIPGSRVVGFVSPEDFLRNPAFR

    >gi|145219392|ref|YP_001130101.1| rhodanese domain-containing protein [Prosthecochloris vibrioformis DSM 265]
    MYYPPTPLNKQVYDYMTKVKDIDPTAAFAMTKKGALLIDVREAREVKRTAFDVDEVMLMPMSRFSGMMKEIPTNRKVILA
    CHTGSRSIMATRMLEKHGHKRVLNMQYGIAKWERTGLPVKKAPKQPPFAWLKKLFGKQS

    >gi|145219547|ref|YP_001130256.1| bifunctional methionine sulfoxide reductase B/A protein [Prosthecochloris vibrioformis DSM 265]
    MNLILMILFLTAAYGCTAPTQKEDGVSYNDLSPDEKRVIENKGTERAFSGKYYLNKEAGVYLCRRCDAPLFRSEDKFESG
    TGWPSFDDAIPGAVREVPDADGRRTEIVCSNCGAHLGHAFFGESMTEKNVRH
    CVNSVSLDFSPRATAPGLEEKAVFAGGC
    FWGVEHRLAELKGVRSVTSGYTGGRSENPSYREVCSGDTGHAEAVEVVFNPAEVSYETLAKLFFEIHDPTELNRQGPDRG
    TQYRSAVFYRNDEQRSVAEHLIAELKAKGYPVVTTVEKAGRFWPAEEYHQDYYEKTGHEPYCHIYTKRF

    >gi|145219601|ref|YP_001130310.1| electron transport complex, RnfABCDGE type, A subunit [Prosthecochloris vibrioformis DSM 265]
    MAEYLLVIVSAVFVNNVVFARFLGICPYLGVSKKIDTALGMGFAVTFVMTLATAITYVLYYGVLVPFNIQFMQTVMYILV
    IASLVQLVEIVLKKVSKSLYSALGIYLPLITTN
    CAILGVALIAIQDKYSLVMSVVFAFFSAIGFILAIVIFAGIREKLED
    ADIPGPFKNVPIGLISAAILSLAFMGFSGLVK

    >gi|145219602|ref|YP_001130311.1| SoxR-reducing system protein RsxE [Prosthecochloris vibrioformis DSM 265]
    MNEAINTLTRGFIKENPVTKMLLGLCPVLAVTTTAVNGLGMGLATTFVLIGSNVVISMTSKMIPDTVRIPSFVLIIATFV
    TIVDMLIKAFSPELNQSLGIFIPLIVVN
    CMILGRAEAFASRSGVWYSLLDGIGMGIGFTLALLALASIREVLGSGTIFNM
    PLIGEDGTPLLVFALPPGAFAGLGAIIALMNALEKKRGVN

    >gi|145219632|ref|YP_001130341.1| OsmC family protein [Prosthecochloris vibrioformis DSM 265]
    MLIICPSARHMPLLSLNFILKCTAMGDNMVISFGGGKKVNASYRGFTIQTDQSVNGGGEGSAPEPFALFLASIGTCAGIY
    VFLFCEQRGIPTDNIRIVQSHEPREDGTGVGKISLSIDLPSDFPAKYRTAVISAANLCAVKKHILDPPVFEVAATIAEG

    >gi|145219651|ref|YP_001130360.1| 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein [Prosthecochloris vibrioformis DSM 265]
    MAKIGVFVCHCGENIAAKVDCTKLVAAMESHPGVAIAHEYKYFCSEPGQESIKKAVTEHGLTGVIVAACSPRMHEATFRT
    ACAEAGLNPYLCEIANIREQCSWVHSDGEQATRKAIEITRSLVEKVKRNNELQPIEVPVTRRALVIGGGIAGIQAALDIA
    NAGGDVVLVEREASLGGHMAQLSETFPTLDCSQ
    CIMTPRMVEAARHPKIRLLTYSEIEKVEGFIGNFNVTVRQKARYVDM
    NLCTGCGECIIKCPAKKISGEFDCGLANRTAIYTPFAQAVPNKPVIDSGHCIYFKNGKCKACQRVCPTGAINFDMEDELV
    ELEIGAIVVATGFQVQNTALYGEYGYGRYPDVLTGLQFERLASASGPTGGKIQRPSDGKEPETIVFIQCAGSRDPSKGIP
    YCSKICCMYTAKHAMLYHHKNHDGNSRIFYMDIRAAGKGYDEFTRRAIEEDGAGYVRGRVSKLWQENGKLMVRGADTLLG
    RPVEVAADMVVLATAMVPQSDSKELGKTLGIGYDEYGFFNEAHLKLRPVETATAGIFLAGACQSPKDIPDSVAQASACAS
    KVLALFSREKLEREPVIAQNNEATCSGCWGCVLACPYNAIEKKDLTDRAGNLIRRVASVNAGLCQGCGTCVTFCRSNSID
    LAGFTEKQIFAEVMGL

    >gi|145219789|ref|YP_001130498.1| thioredoxin [Prosthecochloris vibrioformis DSM 265]
    MNPSLPFDFQCDVLELSHDRPVLVDFWAEWCAPCRQLAPVLERLAGKYEGRFTLVKINTEEHADIASRFQVRSIPMVLLF
    SAGEVIDSFSGAIPERQVEEWLNRHLPGPYAKEIALADEFVREGKRSMALSVLEGVMQKEKGNVTVHALLSKLKLFSSPQ
    EALGLAELLEAEPEHAELSETVRTLARLLRAPANSFPDDEVRNDYLDAVEKLRREDLEAALEGFISVLQRNRPYDDDGSR
    KACIAIFRYLGEEHDIAKKYRKTFDRAF

    >gi|145219818|ref|YP_001130527.1| thioredoxin reductase [Prosthecochloris vibrioformis DSM 265]
    MEREVRDIVIIGTGPAGYTAAIYTGRANLNPLVIDGYQPGGQLMITSEIENFPGFPEGIAGPELMGRMRDQAAKFNAEFV
    FGSVTEADLSRRPFCLTLEDGSEVLARSVIIATGANAKWLGIESEDRYRGRGVSA
    CATCDGFFFRDSTVFVIGGGDTAME
    EALYLTKFASRVVLVHRREEFRSSKIMSLRASKNPKITTMLSRTVDEILGDGQKVTGIRLKHVETGELEELPCDGVFMAI
    GHAPNAQMFAGQIETDDYGYIVTKKASTETSVAGVFACGDVQDYTYRQAVTAVGTGCMAAVDAERFLESIR

    >gi|145219819|ref|YP_001130528.1| thioredoxin [Prosthecochloris vibrioformis DSM 265]
    MSGKYFEATDQNFKTEILDSDKVALVDFWAAWCGPCMMLGPVIEELAADYEGKAIIAKVNVDDNPNTAAQYGIRSIPSML
    VFKNGQVVDQMVGAMPKNMIAKKIDEHIG

    >gi|145219861|ref|YP_001130570.1| methylated-DNA--protein-cysteine methyltransferase [Prosthecochloris vibrioformis DSM 265]
    MNISFRHTLIGTIGIAEENGFITNLFFDGELPVPEPPAEAPPLTCEAFRQLDAYLDGELQTFSLPLAPHPTVFAGHVRQG
    LLEIPYGSTASYAAVAEAIGASSAARAVGTACSRNPLPIFIP
    CHRVVQSSGRFGGYRGGGALKAALIQLESESGGGNSFR
    W

    >gi|145219867|ref|YP_001130576.1| dihydrolipoamide dehydrogenase [Prosthecochloris vibrioformis DSM 265]
    MDAMSESSVTQYDLALIGSGPGGSEAAMLGARAGLRVCIIEKGAPGGVCVNWGCIPTKALLRSAEMFDSLKKGPSFGVSA
    SDGAFDLAAAVKRSRTVAGKMSKGVAFMLRKAGVEFLQGEAVFRSPTEVDIVREGSRIGSVHAKHFIIATGGRPRSIPGM
    EPDRRRVITSRDALAMTALPASMLVLGGGAIGVELAWFYATAGTKVTIVEMADRLLPQEDGEISEALRRSLEKTGIRVAT
    GAKLENVAVQDDGVSAALLIEGKEDERVTAEQLLVAVGVGGNTEGIGLEAAGVCVERGFVVTDASCRTSAPGIYAIGDVR
    GGMLLAHKASAEAEIAVKTILGEKSAPLHDSHIPRCVYAEPSIASIGLSEEQALQEGVAVHIGRSAFAASGKANAYGSLE
    GMVKLLFSAEDGRMLGGHCIGHGAVELIGELALALSFSATAGQLTSVVHAHPTLSESIRDAAMQVS

    >gi|145219887|ref|YP_001130596.1| thioredoxin [Prosthecochloris vibrioformis DSM 265]
    MASSLDELIKTSSTPVFVDFWAAWCGPCKMVAPSVKKLAEEFKGRLTVVKVNVDEQPSAAARFQVQGIPALMLFKNGEKV
    WSTAGALSYPQLKAEVEKVLR

    >gi|145219910|ref|YP_001130619.1| thiol peroxidase (atypical 2-Cys peroxiredoxin) [Prosthecochloris vibrioformis DSM 265]
    MATITLKGNTIQTVGTLPAVGSEAPFFCLVKTDLSEAGPADFAGKRMVLNIFPSLDTAVCAASVRRFNKEASSFDNTVVL
    CISADLPFAHKRFCEVEGLDDVISLSVFRSPAFGSDYGVSIADGPLRGLLSRAVVIVDADGRIAYTEQVPEIVEEPDYDA
    ALAALA

    >gi|145219948|ref|YP_001130657.1| redoxin domain-containing protein [Prosthecochloris vibrioformis DSM 265]
    MALLKEGGTAPDFTGIDQHGKSVSLSEYRGSKVLIYFYPKDDTPGCTAEACAFRDNLPNFNKLGVTVLGVSTDPEAKHRK
    FADKYSLPFRLVADSDKVIVQAYGVWGPKKFMGKEYMGTSRVSYMIDEDGLIAKVWPKVKPAVHPEEVLGWLQANK

    >gi|145219958|ref|YP_001130667.1| amine oxidase [Prosthecochloris vibrioformis DSM 265]
    MPIQDELLDVLVVGSGIGGLTAAALLQQQGFQVAVFEKNRFPGGSCSSFSRSGYTFDAGASVFYGFAGDGQSGTLNLHEK
    IFRKLGVTVPTVPDPVQIHYHLPGGFSLAACYDRTLFLERLQAAFPHEREGILKFYAELEDVYDILSSLPAGSLEDIRHL
    LRVGGSFPLKTAALAVKTFQSMGKRARQHISDPALLHFIDIEAYSWALQDAVSTPLVNAGICLADRHHGGINYPLGGSGS
    IARGLVEGFEACGGEMRYGTEVSEILVDKGSAMGVRLADGSVVRARAVVSNATVWDTFNRLVDDNRYRIPMDRFIEAPSW
    FQLYLGVEGSVVPEGMDVHHVLVDDWSRFSDSGGTLYCSVPSLLDPSLAPSGRHCVHAFVTDRADEWAGLEPGSAEYRAR
    KDERTRELLERLESMMPGISAGCELTISATPLTHQRYLNRYKGSYGPLLRPGQNILLKPQNTTPVKNLFATGDSTFPGQG
    VIAVTYSGVSCASFIAAKFGRPMEPLGSAPEGQDAASSMSISR

    >gi|145220000|ref|YP_001130709.1| peroxiredoxin [Prosthecochloris vibrioformis DSM 265]
    MSQHLEEEMYYDISMPLLGDEFPELEVQTTHGPMNIPGDLKGSWFVLFSHPADFTPVCTTEFVAFQERVQEFDKIGCKLI
    GMSVDQVFSHIKWVQWIKEELDVDITFPIVAANDRIANKLGMLHPGKGSNTVRAVFVGDTHGKVRLVLYYPQEIGRNMDE
    ILRAVQALQISDKHKVAMPADWPNNTLLKDRVIIPPATNVADADKRPQQYECYDWWFCHKPLDK

    >gi|145220123|ref|YP_001130832.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Prosthecochloris vibrioformis DSM 265]
    MSVLVGRKAPEFNVEAVVGGSQFVDSCKLSDFRGQYVVLFFYPLDFTFVCPTELHAFQEKLEEFKKRNVEVLGCSVDSKF
    SHLAWLNTPHNRGGIQGVTYTLLSDLNKTVSADYDVLAEGAGVALRGLFLIDCEGVVRHQVVNDLGLGRNVDEVLRMVDA
    LQFTEQFGEVCPANWNKGDKAMKPTDEGLKDFFKND

    >gi|145220293|ref|YP_001131002.1| redox-active disulfide protein 2 [Prosthecochloris vibrioformis DSM 265]
    MLQVKILGTGCAKCGQLADTVRAVIAADGIAAEVEKVQDMQEIISYNVLSTPALVVDGAVRSAGRVPSAEEIRSMLAPRT
    RGCCCKGSSGASGSSCC

    >gi|145220397|ref|YP_001131106.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Prosthecochloris vibrioformis DSM 265]
    MKKSVDVLVIGGSAAGIAAATTGKAFYADKSFMIVRKEREAVVPCGIPYIFGTLKGVEQNVIPNAHIEGAGVELVIDEVV
    SLDRETKTALTANGLEISFDKVVIATGSQPRVPGWLKGRDLQNVFTIPKDRNYLADVRERIEPCEKIVIIGGGFIGVEMA
    DELIKKGKQITLVEVLPHVLSLAFDSDLSLKAEGILKERGVTLRTNEKVLALEGEGGAVRRVMLEGGDTLQADAVILAMG
    YAPNVALAEKAGMKLNELGAIKVDEYMRTADKDVFAVGDCAEKFSFITRIVKGLMLASTAVSEARIAGMNLFGLSRLRTF
    GGTIAIFSTAIGGITFAAAGVTEDLARERGFDVVSAGFEGIDKHPKTMPGTAAQFVKLIVNRESGLVLGGAVTGGVSAGE
    LINVIGVIIESKMTINELLTMQFGTHPLLTGPPTGYPLLKAAEAVEIKLRHLDRCVCGAPEKAG