Chlorobium phaeobacteroides DSM 266 uid58133

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|119355900|ref|YP_910544.1| redoxin domain-containing protein [Chlorobium phaeobacteroides DSM 266]
    MNNMNRIITIVAAGFMLLLATVSTAGAAQPGTQYPVAPSFSVTGIDNRTITSQSLAGKVYIVNFFASWCPPCRAEIPAMI
    ALQKAYKAKGFTFVGLAVNESGSTIRKFSLANGINYPVALADSKIIADYGRFIDGGIRAIPTSFIVDKSGRVVGIISGAR
    DKAYFEAVILDLLKGTKPTK

    >gi|119355940|ref|YP_910584.1| methionine-R-sulfoxide reductase [Chlorobium phaeobacteroides DSM 266]
    MHRMLMFIFFATVGLFACSGEPTSPKFSPSKAMSDSRALNPYYSRTDTTKLDLPDSVWKKVLPPEVYEVARKAGTERAFT
    GKLWDFEGIGTYYCAACGNALFRSDAKFASTCGWPSFFETVRPGSVEYRTDMAFGMARTEVLCGRCGAHLGHVFDDGPPP
    TGKRF
    CMNSIVLDFEPDEGD

    >gi|119355974|ref|YP_910618.1| rhodanese domain-containing protein [Chlorobium phaeobacteroides DSM 266]
    MRRFIELIRNCLTDVREIMPWELVDRMRLNPELMILDVREPAEFDAMHISGSLCVPRGILESACEWDHDETVPELVKARE
    REIVVV
    CRSGHRSVLAAHSMQVLGFEDVVSLRTGLRGWNDYEEPLRNSAGEVVDSEVADAFFTSKLREDQKRPAEKHQA

    >gi|119355982|ref|YP_910626.1| DsrE family protein [Chlorobium phaeobacteroides DSM 266]
    MKIGILLKEGPYNHQASDTAYKFAEAAIKKGHTIDAVFLYNDGVGNVTKMMDPPQDDRNIAARWDALSKQHGVEILACIA
    ASKRRGINDDVIIEGGTITGLGTLTDIAIRNDRLITFGD

    >gi|119356004|ref|YP_910648.1| rhodanese domain-containing protein [Chlorobium phaeobacteroides DSM 266]
    MIQKGALLVDVREPHEVARKSFDVPDSMLIPLSQLHKRFKEIPAKRQTVIACRSGNRSVTAVRFLMSHGYSKAVNLQDGI
    IRWEKEGLPVRRPLKQKSGSWFTRLFGRKSPVQ

    >gi|119356091|ref|YP_910735.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Chlorobium phaeobacteroides DSM 266]
    MKKNVDVLVIGGSAAGIVAASTGKAFYPLKNFLIVRREREAVVPCGIPYIYGTLESINQNIIPNAHIEQAGVELFIDEVV
    AVDRGAKVATTADGTQITFDKLVFATGSMPKVPAWLKGTGLGNVFTIPKDRDYLENLRMTLEQCTNIVIIGGGFIGVEIA
    DELRKKGKRITLIEVMPHVLSAAFDDDLSVKVEKILTDNGVMLRTGEKVRELSGEGSVSGVVLENGEILAADAVILATGY
    APNVDLARNAGIKINELGAIRVDEYMRTEDKDIFAVGDCAEKFSFITRIVKGLMLAATACSEARIAGMNLYGLSRLRTFS
    GTISIFSTAIGGTTFAAAGVTEHLALDRGFDVISASAEGIDKHPKSLPGTSSQFVKLIVNRDSGLVLGGAVVGGVSAGEL
    INVIGVIIENKMTIHEVLTLQVGTHPLLTGPPTGYPLIKAAEAVVKKLRSSR

    >gi|119356204|ref|YP_910848.1| glutaredoxin 2 [Chlorobium phaeobacteroides DSM 266]
    MTESLHTVTIYGAKGCCLCDDALERVLDVQGSVPFLLEKTDISGSPELQQQYGEAIPVVCIDGVEVFRYRVNKTRLLQIL
    RGQGGV

    >gi|119356300|ref|YP_910944.1| redox-active disulfide protein 2 [Chlorobium phaeobacteroides DSM 266]
    MKRVKVLGSGCAKCGQLMDAVKAVIAAEGLDASVEKVEDMQQIMAYQVLSTPALVVDEVVLSRGRVPSRDELKDLLTR

    >gi|119356301|ref|YP_910945.1| rhodanese domain-containing protein [Chlorobium phaeobacteroides DSM 266]
    MKQVVDVCPTTALGMIERGALLVDVREPDEVAGASFAIPDVMLVPFSEFEERFREIPVERDLIIGCMVGERSLRAASFLM
    HHGYERVFNMQDGIVRWAEKGYPLRGSLTGTSHACCCGGTSHGAANNGGKCC

    >gi|119356306|ref|YP_910950.1| redoxin domain-containing protein [Chlorobium phaeobacteroides DSM 266]
    MIKQFGVMIPSRTVAFALCIALCTVICQPLLAGAAEKRDKAALKVTSAPGFAARSVQGAPISSDKLRGKAYIVNFFGSWC
    PV
    CRKELPDMVALQEKYEKKGFTFIGMAYKDNAQSLPDFIWEHSINYPVVVADQTIVTAFGRQISGGLRAVPALFAVNSE
    GKLLSVVVGAQSKAAFEELILNTLASGKKK

    >gi|119356597|ref|YP_911241.1| NADH:flavin oxidoreductase/NADH oxidase [Chlorobium phaeobacteroides DSM 266]
    MYTRLFSPITIGSVEIKNRVAMTAMGVNLAAAGGGINDDIIAFYEARARGGTGLIISGICRVMDGEGAGEACQIAARNTA
    DLQGLGRLVDTVHKYDTRLFLQLHHPGRNYGLGSEQPVSASPVTTLFHCKTPRALTVPEIETIQQAFVNGAHLARVAGAD
    GVELHGAHGYLINGFLSPYLNKRTDQYGNSFENRMRFLLEIVSGIRNRCGKNFPIGVRLSVDEFLGQYGNDLATSCRIAS
    ELELAGIDFLDISCTIPDSPEINACIEPGTFEQGWKKYMAAEIKKFVKIPLIAVANIKDPDIAEAILEENCCDLVGVARG
    HLADPEWCNKAKTAGMEQTIRKCIGCLVCFDEIEHGRHVKCSVNPKTGREREFENMVHNGAGRTVAVIGGGPSGITAALV
    LQQRGFQTVLFDPLPRLGGMLNVADKGIGKDKITC
    CVESMIVQSDRSGIQLRLGENATIDKIKSLSPCGVFIACGAEPLI
    PEIPGIDGQNVFTAEDVLLKKVRVIGDCIIAGSGMTGLETAEVVVREGHKTTLIDMLPEIGYGAEPTVILDIRRRMEQYN
    PTYMPGHKLVRIIPDGVDVENIQNGLTVFVPARTVILALGVRPQKTIVEQFKAAFPEAKVIGDASHGGRILDATQDAYGK
    AFVFNP

    >gi|119356660|ref|YP_911304.1| radical SAM domain-containing protein [Chlorobium phaeobacteroides DSM 266]
    MTLQPSLHKRKSLLADTREQVMVLEQTDCHIESFNSKLRKTGVAHLNRDATAILQVNTGYRCNLLCRHCHVDAGPDRTEM
    MSRQTMQDCLNALKNSSIRTLDITGGAPEMNPELPWFIREARKIMPEGEILVRTNLVILVSGTGYRHFPELFKENRVSLI
    ASLPCYTRQNVDAQRGDGVFDRSIEALLLLNSLGYGKNGSGLELNLVYNPGGPSLPGAQKTLEADYKIKLKTEFGVEFNH
    LYTITNMPVSRFLESLLKEENFCNYMKLLSDNFNSEAVKNVMCRTTVSVGWDGTLYDCDFNQMLKLPMRSPAPINIRDFD
    EQLLDQRPVATGQHCYGCTAGAGSS
    CQGCLL

    >gi|119356676|ref|YP_911320.1| alkylhydroperoxidase [Chlorobium phaeobacteroides DSM 266]
    MTINYFTETHPAYRDKLTILVMAQVRKEFGAEVEPFLLHKPIPELLAGSWMACRETLISGIANREAKEVVAAVTSMMNRC
    PY
    CVDAHTVMALGASGRDYTGTIASGRYETIRDPFMRSMAEWGSATRSPDSPVLRYPPFNPDEAPEYIGTVLFFNYINRM
    ATILLGASPLPFTDGIMKNISMRLAAFFFSSAIHRTKQPGTSLDLLPNEPLPDDLAWAKPSPFVSGALARFSAAIEKAAE
    TVLTEKTAGMVIDQLDRWDGSDPGISSSWCEHLLFRLNDSEKTVARLALLTAIAPWQISNEMVRAFSAYHSGDKALLSIL
    SWSSLSAARRISRWLA

    >gi|119356712|ref|YP_911356.1| redoxin domain-containing protein [Chlorobium phaeobacteroides DSM 266]
    MSLLQEGSVAPPITTIDQHGKNVTLHEYKGKKVVLYFYPKDDTPGCTKEACAFRDNLPNFNNLDAEILGVSVDSVEKHKK
    FAEKYTLPFRLLVDDEKKIVQDYGVWGLKKFMGKEYMGINRVTYLINEEGVIEKVWPKVSPAGHAEEILNYLQQKT

    >gi|119356739|ref|YP_911383.1| nitrogenase-associated protein [Chlorobium phaeobacteroides DSM 266]
    MASILFFEKPGCQNNTRQKAWLELSGHTVDAVNILEYAWTKEELSLYLGENPISACFNPAAPEVKTGSMKPELLNKEDAL
    DAMIKKPLLIRRPLLKIGNHYLQGFDTAVLRTIISLEAVPGAEKVIKSFITSDFNNCPHSDTLSCNQF

    >gi|119356778|ref|YP_911422.1| thiol peroxidase [Chlorobium phaeobacteroides DSM 266]
    MATITLKGNPIETSGSLPPVGSDSPFFCLVKTDLSEAGPADFEGRRMVFNIFPSLDTPVCAASVRRFNQEAASFDNTVVL
    CISADLPFAHSRFCETEGLKNVVSLSSFRSPDFGSSFGVSITNGPLKGLLCRAVVIVDAEHKVIYSELVPEIVQEPDYSA
    ALKALA

    >gi|119356806|ref|YP_911450.1| thioredoxin domain-containing protein [Chlorobium phaeobacteroides DSM 266]
    MFDFQVEVIEQSHTLPVLVDFWAEWCAPCRMLGPVLEKLAAKYTGSWRLVKINTGEFPELAERYQVRGIPDVKLFVAGEA
    VDGFSGALSEYQIEQWLKKAVPDPYARTVALAETLLAEGRKVDAKRLLEDVLRESPDNLQALALQARILLFCEPEEALRL
    ITLLNDEPDYAELSETVRVIGRLLMQEEANFADSPVKDSYLAAIAAIRSEHYDEAIEQFIQVLREDRYYDDDGSRKACIA
    LFRYLGQEHPVTLRHRRAFDRSF

    >gi|119356828|ref|YP_911472.1| OsmC family protein [Chlorobium phaeobacteroides DSM 266]
    MNNEMIITFGGGKKVNAEYGGFTIHTDQSVRGGGEGSAPEPFALFLASIGTCAGIYVFSFCQNREIPTDGIRIVQSHYPK
    ETGRGIGKIVLTIELPPDFPEKYKEAVINSANLCAVKKHIMDPPEFEVVTMTTEM

    >gi|119357012|ref|YP_911656.1| thioredoxin [Chlorobium phaeobacteroides DSM 266]
    MSGKYLVATDQNFKTEILDSDKVALVDFWAAWCGPCMMLGPVIEELAGDYEGKAIVAKLNVDDNPNTASQYGIRSIPTML
    LIKNGKVVDQMVGAMPKNMIAKKIDEHLA

    >gi|119357013|ref|YP_911657.1| thioredoxin reductase [Chlorobium phaeobacteroides DSM 266]
    MERDIRDIVIMGTGPAGYTAAIYSGRANLKPLVIEGSQPGGQLMITSEIENFPGFPEGIFGPELMARMRQQIIRFGVEIA
    YGSVQDVDLSRTPFSLSLDDGTEIVTRSLIVATGANAKWLNIDSEKMYRGKGVSA
    CATCDGFFFKQCKVFVVGGGDTAME
    EALYLTKFAAEVIIVHRREEFRASKIMSLRAGKNPKISTMLNQVVDEILGDGHKVTGIRLQNVLTGEKTEHQCDGVFMAI
    GHAPNAELFKGQLRIDDYGYIETKKTSTETSVPGVFACGDVQDYTYRQAITAAGTGCMAAVDAERFLESIR

    >gi|119357073|ref|YP_911717.1| 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein [Chlorobium phaeobacteroides DSM 266]
    MAKIGVFVCHCGENIGSRVDCEKLTEAMNNHPGVSVSVQYKYFCSDPGQENVKKAIRENNLTGIVVAACSPKMHEATFRK
    ACAEAGLNPYLCEIANIREQCSWVHSDKDMATEKAIEITRSLIEKVKLNNELQPIEVPVTRRALVIGGGIAGIQAALDIA
    NAGREVVLVEREASLGGHMSQLSETFPTLDCSQ
    CIMTPRMVEAAQHPKIRLLTYAEVEQVDGYIGNFNVKVRLKARYVDM
    KSCTGCGDCMLKCPVKKISSEFECGLGKRTAIYTPFAQAVPNIPVIDKKNCIYFKNGKCKQCAAVCELNAIDFEMQDEII
    NLEIGAIVVATGFQVQNTAMYGEYGYGKYPDVITGLQFERLASASGPSDGKILRPSDGKEPRTIVFIQCAGSRDPSKGVR
    YCSKICCMYTAKHAMLYAHKVHGSKTRIFYMDIRAAGKGYDEFTRRAIEEDEAGYVRGRVSKVWRENDKLMVRGVDTLLG
    RPMEIAADMVVLATAMVPQPDAKDFAKVIGITYDEYGFYNEAHLKLRPVETTKAGIFLAGACQSPKDIPDSVAQASAAAS
    KVLGLFSRDQLEREPVIAENNENTCSGCWGCVLACPYNAIEKKDILNRSGELVKQVAFVNPGLCQGCGTCVTFCRSNSID
    LAGFTERQIFAEVMGL

    >gi|119357267|ref|YP_911911.1| bifunctional methionine sulfoxide reductase B/A protein [Chlorobium phaeobacteroides DSM 266]
    MVNNRKTGISVSAALAAVLLGIALFLFYQSGTGSFPFTSKATSIQKETHMTQRPLTPEEERVIVHKGTERPFTGAYYKNT
    EDGVYHCRRCDAPLFSSKDKFDSGTGWPSFDDAIAGAVKEVPDTDGRRTEIVCARCGAHLGHVFFNEGMTAKSVRH
    CVNS
    ISLLFHPDAEAAPVTQKAVFAGG
    CFWGVEYHFSKTKGVLSVTSGYTGGSIENPSYKQVCSGRTGHAEAVEIAFDPRVVSY
    EALAKLFFEIHDPTQLNRQGPDMGTQYRSAVFYSDEEQKKTAEKLIGELKEKGYNVVTTIEPAGTFWNAEEYHQDYYRKT
    GHQPYCHIYQKRF

    >gi|119357268|ref|YP_911912.1| hypothetical protein Cpha266_1460 [Chlorobium phaeobacteroides DSM 266]
    MNRSERKPNRLIDEKSPYLLQHAENPVDWYPWGVEAFAKAKKESKPIFLSVGYSTCHWCHVMERESFEDPRTALLLNTNF
    VPVKVDREEYPDLDRLYMTFVQSTTGRGGWPMSVWLTPDLDPFYGGSYFPPVDRYGMPGFNTLLTSIARLWQTDPQSILD
    RSALFFQQLNSAESVKTEGSLPSKDAANRCFRWLEDSFDRDFGGFGNAPKFPRPVLLDFLFNYHYHTGNEQALAMALFTL
    RKMAEGGIHDHLGIPEKGGGGFSRYSTDPFWHLPHFEKMLYDNAQLAISFVQAFQCSGDSFYAEVADDIFNYVLTDLASS
    EGAFYSAEDADSLPEQSSSVLEEGAFYRWSHEEVLRLPCSRRSIELFSRLYGIRPEGNVLNDPHNEFAGLNILKKESSIE
    EIGRIFSMREKEVAEALEEVRLALHNARLARPRPFLDDKILASWNGLMISALARGYRVFGDKRLLLAANRATEFLLSTLY
    NRHTGKLLRRYRNGSAGIDGKADDYAFFVQGLLDLYEADFDPRHIETAIALTETVILLFEDTIKGGFSSTASDDTSLPAR
    MREEYDGAEPAANSVLAMNLLRLSEMTGEERYNEKAENIFKAFDSILDTNSHALPAMLVALNFWEQKKSLTILNGDPASP
    VMQELKRAPGRRYLPGNVTIHASIRQVVKGLDVLEQIEESPAIPRAYVCLDRACQLPVSDPISLMALLSNSFRETEGYPQ


    >gi|119357367|ref|YP_912011.1| methylated-DNA--protein-cysteine methyltransferase [Chlorobium phaeobacteroides DSM 266]
    MKLFCKKTGIGTIGIVDSGGVVSNLFFDPCSVSQEIERGETPLAIEAFRQLDAYLRGDLKAFSLPLEPTGTPFMKRVWEV
    LSVIPYATRVTYSEIAKAAGNPRAVRSVASACGRNPLPLFIP
    CHRVVRSDGKMGGYLGGSVLKAGLLELEKKSAYDDPSF
    YMNVHDC

    >gi|119357377|ref|YP_912021.1| rhodanese domain-containing protein [Chlorobium phaeobacteroides DSM 266]
    MFGSDRLLDVAIMMIERTHRVENLETSELAAMLAGPEPPLLFDIRTAGEYEKSHIETAIRIEPDIGQDDFETLYAALMAG
    RDIVLY
    CSVGQRSSELLERVESARGKTGAKSCRNLRGGIFRWYNEGRPVVDASGTTDDIHGYDPVWAVMVERRR

    >gi|119357433|ref|YP_912077.1| dihydrolipoamide dehydrogenase [Chlorobium phaeobacteroides DSM 266]
    MHFRYSILKPYDYLFMQQGSADEGFAFDLAVIGSGPGGYEAALKAAKAGLKVCLIEKGALGGVCVNWGCIPTKALLRSAE
    IIDLVARSSSFGIMAENVSFDFPQAVKRSRSVVRKLSKGIDFMLQRAGVEVKQGEARFTSPHDLDIVRDGIGVDHIRARS
    VIIATGSIPREISGLEPDGNRILGSRDALALKTLPSSMIVVGGGAIGIEMAWFYAKAGTVVTLVEMMPRILPLEDAEIAL
    ALRRSLEKAGILIYTGAKLERLSSDERGVNCRITVAEEDPIAVHAECLLVAVGVTGNTCELGLSNAGVECSGGYIVTDGE
    CRTSADHVYAIGDVRGGMLLAHKASAEAAIAVASISGKTSEPLDDTKIPRCVYVEPSLASVGLSEEQAVASGFSVRIGRA
    MFAASGKANAYGNLEGMVKLIFSCKTDRLLGAHVLGHGAVELIGELCLARQLELTARVLAGTVHAHPTLSETIREAAENS
    LEA

    >gi|119357517|ref|YP_912161.1| thioredoxin [Chlorobium phaeobacteroides DSM 266]
    MAQSLDDLIKTSQLPVFVDFWAEWCAPCRSVAPVVKQLAQEFNGRLTVVKVNVDKQPDAASRHQVQSIPALMLFHRGELK
    WRTAGAISYPQLKAEVMKVLGA

    >gi|119357674|ref|YP_912318.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chlorobium phaeobacteroides DSM 266]
    MGVLVGRKAPEFCVEAVTGGSRFVDACRLSDYAGKYVVLFFYPLDFTFVCPTELHAFQDKLDEFTKRNVEVIGCSVDSKF
    SHFAWLQTPRNRGGIEGVTYTLLSDINKTVSSDYDVLVDGAGISLRGLFLIDREGVVRHQVVNDLGLGRNVDEVLRMIDA
    LQFTEEFGEVCPANWNKGDKTMKPDDEGLKEFFKDA

    >gi|119357758|ref|YP_912402.1| peroxiredoxin [Chlorobium phaeobacteroides DSM 266]
    MSDHIDDNYYYNDSGMPLLGDEFPEMKVQTTHGPMNIPGDLKGSWFVLFSHPADYTPVCTTEFLAFQERVADFDKLGCQL
    VGMSVDQVFSHIKWVEWIKDNLDTEITFPIVAANDRIAMQLGMLHPGKGSNTVRAVFVGDPDGKVRLILYYPQEIGRNID
    EIVRAVKALQVSDKHKVAIPANWPINSLLKDRVIIPPANNIEDAKKRPSQYDCYDWWFCHKPLEG

    >gi|119357912|ref|YP_912556.1| hypothetical protein Cpha266_2124 [Chlorobium phaeobacteroides DSM 266]
    MKLGIIIYSDDPETVWNTFRFALKATEEGELVTVFLTGRGVEADTDVLDTGRFEVNELKRRFLAAGGVLLCCGTCSMTLR
    GKTPVSASKGGLKDMLDIIRDSDRVLTF

    >gi|119357913|ref|YP_912557.1| ArsR family transcriptional regulator [Chlorobium phaeobacteroides DSM 266]
    MTTKQELKALVYEQVARIGKALSSPKRLELLDLLAQGEKSVEILANEAGIDKQLASAHLKALREARLVNTRREGKYIFYR
    LSAQSVSRLCVNLRETAEEHLVELRDALAQMTSQPETLVSETREVLLEKARKGEIVVIDVRPPTEFNIAHLPYARSMPLT
    EIEQRLAELPRDKEIVAY
    CRGPFCLLSEDAVAMLGAHGFHIKRMLDGVSEWEAAGLSLEHG

    >gi|119358300|ref|YP_912944.1| heavy metal translocating P-type ATPase [Chlorobium phaeobacteroides DSM 266]
    MTTRTYSVKGMHCASCAAIITKKLSKVEGISQVDVNLATEQAKIGFESNGLTLEALNEVVGKYGFSLAVDHPEEIVCGVQ
    SASVSSAVRLKEEKQRELLEYKAKVEFALPVALLVFILMMWDIGARFFPFVPNLPIPMDLLNVISMALSTYMVFRTGAPF
    LHGIVMFARSGAASMDTLIGIGTLSAYMYSALVTLIPSVRTRLQLPDYTYFDVTIVVIGFVLLGKYLEARSRLKTGEAIE
    KLITLQAKSAFVQREGKEFEIPAEQVRKGDVVIVKPGEKIPVDGTIVLGSSSIDESMVTGEPVPVDKKSGDQVIGGTINK
    QGSFTFTASHVGTDTVLARIIRMVEEAQGSKAPIQDIADKVAGVFVPVVLVLAAVTFLVWLTVGSSLLGFSAAFSYGIMA
    LVGILVIACPCALGLATPTAIIVGIGKGAEYGILIRNAESLERLSAVDTVVFDKTGTITTGRPVVTDIAAFDSRMSHSSL
    LQLAASLEYRSEHPLAQAIVEAAKKQSLSLSDTIGFEALEGLGVAGLIDNLPVRVHKPVETELSIPEVNALQKQGKTVVM
    IEQSGECVGLIALSDTVKEHAGEAVAALHRKGIKVIMLTGDNLLAATYMAGQVGIDEVIAEVLPQEKAGKIRELQAKGRT
    VVMAGDGINDAPALAQADVGIAMATGTDIAIESAGITLLKGDIKKVAEAITLSRATMSVIRQNLFWAFIYNIIGIPLAAG
    ALYPFWGIFLNPVFSGIAMAGSSVSVVSNSLRLKTIKLDKKR

    >gi|119358320|ref|YP_912964.1| redoxin domain-containing protein [Chlorobium phaeobacteroides DSM 266]
    MIAEGVKAPAFSLPDASGRMISLSDCIGQKVLVIFYPGDDTPVCTAQLCDYRNNVLEFTRRGIAVLGISGDSVESHRLFA
    EKHELPFTLLSDSDKRVAKAFDALGFLGMSQRAYVLVDETGVVLLAYSDFLPVTYQPMKDLLARIDAAS