Chlorobium phaeobacteroides BS1 uid58131

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|189499032|ref|YP_001958502.1| Redoxin domain protein [Chlorobium phaeobacteroides BS1]
    MRFFKLCTVLSISLVIIACKTEPAETAKPQAATVEETQVVMAPEFAGKTLEGADFSSQELSGKVYILNFFASWCPPCRAE
    VPDMIELQNEYEQKGFTFIGVTVDEDLTKARQFVDDFGINFPVLVADQQMIDAYSDHVQGGLRSIPTSFVISADGSISSV
    LVGAQSKMAFDGLIREVIGAGK

    >gi|189499084|ref|YP_001958554.1| methionine-R-sulfoxide reductase [Chlorobium phaeobacteroides BS1]
    MHSTVRCLKAPQAVLFLLLMLPALLAGCGGATFPENEKDDSMISKQEKPGNPYYSRTDTTTLDLPDSVWAKVLTKEVYRV
    ARQKETEQAFSGKFLDFEGRGSYFCAACGNALFRSDAKFADTCGWPSFFEPVREKSIFYQPDTSHGLVRTEVICGRCGAH
    LGHVFDDGPPPTGKRF
    CMNSIVLDFEPDGE

    >gi|189499239|ref|YP_001958709.1| Radical SAM domain protein [Chlorobium phaeobacteroides BS1]
    MRNSIASWDRYSIDATPIYFSRKTADWFVPNQEGDRVLQSLYNKNGDCYGKEDNRFLSRLPEQGSPGYTGRASSLTLKNI
    RELWFHITNRCNMACSHCLFSSSPEEEAELSAEDILSLAGEAWQQGCRLFALTGGEPLVHREIDRIVNGILELPDTHLVI
    LTNGLLIKKLFSSLNGDSHRVHLQISLDGLEENHDSLRGKDAFSKLTANLQWLKKEGIFYTLSMCVTRQNIPDMEPMIDF
    AASVGAKNVHFMWYFIRGRGTGQQFAHPEELFINLTLAARKAEKLGIPIDNIESLKSRVFSPPGTIHDGSTAGWESLAIG
    PDKKLYPSAALIGIPELSISLDEGLVNAWKNSPVLETVRNASIVDTASPMRFILGGGDIDHSYIHNGTFSGSDPYLPLYE
    RTVLWLIAGSVPEENATTRNPALRVQMGEILESCSAHGSIALIHSNCLLATASQSSLFSIQDFYTDAVGDKNEAILNPVG
    YDTALVNHIPSEYRFRGYGCGSPVLDAGISEGDDIVDLGCGNGVECFIASRLTGKNGSVRGIDMLDPMLHMARKAEKSVA
    ENLGYNNVSFLTGYLETLPLETASADVVLSNCVMNLSVNKRKAYAEILRVLRPGGKLVISDVVCETEPDASISNDETLRG
    E
    CIAGALSESHLMALLEETGFEATQLIKRFPYRNIQGHPFYSLTYSSVKPRLTETVTAMYRGPLPELVTCRGTILRPGKK
    TFIDRTEAEMLGESLFIFDEHDYVVNIEAENCCSCSIAPDEKQMNGQDKESGSSPEKRHASGCMICGEQLIYTENEQEHS
    CGYCGRKYSSSSLCGKGHYVCDTCHSDDAVEVIKHICLATEETDMIELMERIRSHPSIPVHGPEYHAMIPGIILATWRNL
    GGDIHDMIIESGINRGKTIPGGSCGFMGICGAATGTGIAFSILLKANPVKAAERKNVQQITAAVLEEIAALQAARCCQRD
    CWIALKKAAELSKEIMDIPLRAEKVLKCKQHEANKECFGKNCPIY

    >gi|189499273|ref|YP_001958743.1| alkylhydroperoxidase like protein, AhpD family [Chlorobium phaeobacteroides BS1]
    MTIRYFKAAGGGQKNDLAERTLMHINSEFGARVEPFTLHLPQPELLAGVWMICRESLLVGSVRRDLKEAVATTVSVINRC
    PY
    CVDAHGIMILGASGKSYAEAITAGTYDAIDDKDVRKAVEWAAATLLPGSSILADPPFSPDEAPEYIGTAVCFHYINRM
    VTILLGPTPLPFGKGALKRVSMRLASWFFGRSIRVYKEPCASLELLPRATLPGDLGWASASACIAHAYAAFSGTVERAGE
    KVLTEQVRESISKVVKAWNGKDPGMGRAWIEESLGACTGGQRAAGELALLAALAPYLVTPAEVSSFSAYYPGDRELLAVL
    AWGSFTAARRAGGWMS

    >gi|189499374|ref|YP_001958844.1| glutaredoxin 2 [Chlorobium phaeobacteroides BS1]
    MYDSNVVLYTKPGCSLCEKAGRAVERVLADIPFALEVVDITTSSELLQRYGLYIPVISIDGVEFSRYHVNESKLRALLNG
    ERTQGTLRG

    >gi|189499447|ref|YP_001958917.1| NADH dehydrogenase (quinone) [Chlorobium phaeobacteroides BS1]
    MNQKPSKPLEIIVGEGTCGIAAGSKDVIDIFTELAPEAAIKSVGCAGMCHDEVMVEIIDEKRGACLYRKVDKKNIPDLLS
    FHRGEGKVRQDLLIRSSMPSVGADYLDRQTRIALRNIGQVDPQSLDAYRERGGYRSIEKIITEGIKPEQVIEEVRVSGLR
    GRGGAGFPTAVKWGFARSAKGEKKYLICNGDEGDPGAFMDRSLLEGDPHNALEGMLIAAYAIGASSGYAYIRAEYPLAVE
    HFRKAIDDARKAGLLGNNILGSSFDFDVTIKQGAGAFVCGEETALIASIEGERGMPRIRPPFPAVKGLFGKPTIINNVES
    LANLPWIIEHGGAAYAEIGTEKSKGTKVFALAGPIKRGGLVEVPMGTTVREVLYDIGGGSSAGRPIKAVQLGGPSGGCIP
    ESLFDTPIEYEALNATGAIMGSGGMVVMDTKSCMVDIARYFLEFTQIESCGKCTFCRIGTLRMKELLTRICDGQGTMDDI
    DTLEDIAHQVRSSSL
    CGLGQTAPNPVLTTLKYFRDEYVAHVEEKRCPAGVCKGLITHTIMQDTCTGCSICERYCPVDAIT
    GVIKKPESWVIDHDLCVNCGMCVEVCNSDAISVA

    >gi|189499482|ref|YP_001958952.1| redox-active disulfide protein 2 [Chlorobium phaeobacteroides BS1]
    MKTIKVLGTGCATCKQLESLVRQVVEETGIEASIEKVEDIQEIISWKVLSTPGLVVDNEVKCSGRIPSRDEIEEMLA

    >gi|189499614|ref|YP_001959084.1| UBA/THIF-type NAD/FAD binding protein [Chlorobium phaeobacteroides BS1]
    MIDFTQSQLERYSRHILLDSVGVEGQQKLLSSRVMIIGAGGLGAPAALYCAAAGIGTIGIVDADAVEISNLQRQIIHFTD
    DIGKAKVASAREKMEAINPDVKVEPLRAFVNASNISDIIDGYDFVIDGTDNFATKFLINDACIMKGIPFSHGGILRFNGQ
    TMTVLPKESACYRCVFHKPPPKNMIPT
    CSEAGVLGAIAGMLGTIQAAEALKCITGAGEILADALLTFDALPMNFRKVKLQ
    KNPKCAVCSENPSITVLQDEEQQVCDLK

    >gi|189499722|ref|YP_001959192.1| Methyltransferase type 11 [Chlorobium phaeobacteroides BS1]
    MDKEKARKMVREAYGKIVEEEGCCCGETSCCADTAEFAKSIGYTEEELQIIPNESNLALSCGNPTAFANLGNNETVLDLG
    SGAGFDCFLAAAKVGPQGNVIGVDMTPAMIEKARANAKNNGVENVEFRLGEIENLPVADNSVDVVISNCVINLSADKQRV
    FQEIYRVLKPGGKIAVSDSALLKELPVKMKESIEAYVG
    CVGGALTVDALQRTVESSGLCDVTISVKGSSACISFDTKDPI
    GKAILDSLGEHESLDDYVVSVFVEGLK

    >gi|189499737|ref|YP_001959207.1| Rhodanese domain protein [Chlorobium phaeobacteroides BS1]
    MPKVKDVTPSNAYAMLKRGAVLVDVRQPREIARISFDIPDVIEIPLSGFEQRMQEIPAKRKVIVACRRGNRSMYAARLLL
    NNGHQRVFNLEHGIIRWEKEGLPVKSAPKQNLLSTLMSLFSKKS

    >gi|189499810|ref|YP_001959280.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chlorobium phaeobacteroides BS1]
    MGVLVGREAPEFDLEAVAEGAKFVDSCKLSDFRGKYVVLFFYPLDFTFVCPTELHAFQDRLEEFRHKNVEVLACSVDSKF
    SHLAWLKTPRKQGGIEGVTYTLLSDINKVASKAYDVLAEKEGVSYRGLFLIDKDGIVRYQVVNDLGLGRNVDEVLRMVEA
    LQFTEQFGEVCPANWNKGDKSMKPTNEGLEEYFGSE

    >gi|189499897|ref|YP_001959367.1| Thioredoxin-disulfide reductase [Chlorobium phaeobacteroides BS1]
    MNTEHCDVLIIGGGPAGASAAIYTARAELQTLVLDKDPHAGALGMAHVIANYPGVRPDISGMELLDSMKSQAESFGAHFM
    REKVTGIDLRDREKVVFTASGKLFRAKALILATGSMGKSREIPGERELVGAGVSY
    CATCDAAFYKGQVVAVSGRTGEAVE
    EAKVLSRFAGKVYLLCPTTTFAAPDEEVESLGTLPNVDVLYNKRISSINGEGAVESLSITGDESPLFVDGVFLYLTGSAP
    ILDYAGGLLEVRESGCLKVNGDFSTSVPGVFAAGDVLCKDIKQAVIVASEGCRAALQVDRFLSGREKAKSDYH

    >gi|189499997|ref|YP_001959467.1| dihydrolipoamide dehydrogenase [Chlorobium phaeobacteroides BS1]
    MSKESEGKSFEYDVVVIGSGPGGFEAAVKAAQSGLQVCIVEKGAIGGVCVNWGCIPTKALLRSAEVFRLADDAGPFGLGI
    DNAVVDVAQAVKRSRRVVLTVSKGVEYTLKQNNVVLKRGECSFIDAHRLEIKREGKVEETISAEQCIIATGGKARELPGM
    EFDGKTIISSREALAMQAAPGKMLIIGGGAIGVEMAWYYNAAGSDVTLVELMPGILPLEDADIGDGLKRSLVKAGIEIIN
    EAVVKKAETADGGIRAVVGMPDGSERVMDADCMLVAVGVAPETEGLALEKAGVETEKGFVVTDERCRTNVPNIFAIGDVR
    GGMMLAHKASAEAAVAVKGVTGKTCEPVDDTRMPRCVYVEPSVACVGYTERQAAEAGFDIRVGKALFASSGKANAYGHRD
    GFVKLVFEAGTGVLLGGHVLGYGAVELIGEISLARSLGVTAEQIAETIHAHPTLSESIKEAAEDALKDL

    >gi|189500012|ref|YP_001959482.1| nitrogenase-associated protein [Chlorobium phaeobacteroides BS1]
    MDVQIYVKPECMNNRKQVEMLQSKNHLVTEKNIFEEEWTREKLRPFFQNLPLDKWHNPYAPKVKSGEINPKGWDEEQILA
    EMIKDNYLIRRPLLQAGDRQDCGFDSDLALELMASAEVDEVLVCHQAGKVCD

    >gi|189500022|ref|YP_001959492.1| protein of unknown function DUF255 [Chlorobium phaeobacteroides BS1]
    MPQEKRRPNLLAEETSPYLLQHAYNPAAWYPWGEEAFEKARNEDKPVFLSVGYSTCHWCHVMERESFENDRIAELLNRAF
    VPVKVDREERPDIDRLYMTYVQATTGSGGWPMSVWLTPDLKPFFGGSYFPPEDRYGKPGFHSLLLSIERAWKEDRNRFLS
    AAEGMTEQLEALSLQKPETVPLDEQVFHHAAKTFAGMFDKEDGGFGNAPKFPQPSILEFLLAYSYFTGNQEAKEMVLLSL
    RKMASGGIHDHLGIKNLGGGGFARYSTDVRWHVPHFEKMLYDNAQLAVVATEAYQITGENLYANLADDILNYVLCDMTDN
    KGGFYSAEDADSFPNSKSKAKKEGAFYTWSIQEITAKLDPLETDIFCFIYGVESDGNALDDPHLEFTGRNILFARNDIEA
    AAAQFSMPSEIIREITDDAREKLFHSRNDRPRPHLDDKILTSWNGLMISALSKASCVLRSQNYLDAALKAAEFILNNLYS
    TTDGRLLRRYRSGQAGIGGKADDYSFFIQGLLDLYEASSEHRYLSNAVKLMEKQIELFFDDKSGGFFNAASDDSSVPIRM
    KEDYDGAEPSPNSINTFSLYRLADMMDRDDFREIADKTIAYFSKSLKENGRQLPCLLKTAMLPFYGTRQVILTGERHNET
    MKNLENTLGEMYLPDMFIIHASGNNAENTDFLKKITLKSTGNAAYVCSNQTCNLPAYSAKELRKIFSAKNQK

    >gi|189500024|ref|YP_001959494.1| peptide methionine sulfoxide reductase [Chlorobium phaeobacteroides BS1]
    MQYKSLSSEEERVIVKKGTEMPFSGKYFNHKEDGTYTCKRCDAPLFRSSDKFDSGTGWPSFDDEIPGAVKKETDADGRRT
    EIICANCGAHLGHVFYNEGMTDKNARY
    CVNSISLDFKDEGASDADAVGITQKAVFAGGCFWGVEYHFQKVAGVKSVTSGY
    TGGSKTDPTYKEVCTGTTGHAEAVEVEYDPSQTSYEELAKLFFEIHDPTQLNRQGPDRGTQYRSAVFYADEEQKNIAQKL
    IAELKSNGYKVVTELEPASEFYPAEDYHQDYYEKTGHQPYCHIYEKRFDK

    >gi|189500150|ref|YP_001959620.1| thioredoxin [Chlorobium phaeobacteroides BS1]
    MSGQYFTATDQNFKASILDSDKVALVDFWAAWCGPCQMLGPVIEELAGEFEGKAVISKLNVDENPDTAAQYGVRSIPTML
    IFKNGEVVDQMVGAMPKNMIAEKINAQLA

    >gi|189500151|ref|YP_001959621.1| thioredoxin reductase [Chlorobium phaeobacteroides BS1]
    MDNGIQDIVIIGTGPAGLTAAIYTGRANLNPLVIDGCQPGGQLMITSEIENYPGFPEGVRGPAMMGMFRQQAAKFGAKFL
    SGSAVEVDVSRTPFCVYLEDGREILSRTLIVATGANAKWLGLPSEKKYQGKGVSA
    CATCDGFFFKESEVYVVGGGDTAME
    EALYLTRFASKVTVVHRRDEFRASRIMSMRVEKNPKIALELNKVVEEILGDEQNVTGIRMKDVLTGEIQETSCDGVFVAI
    GHTPNSSIFERQLDIDEYGYIKTEKSSTETSVKGVFACGDVQDYTYRQAITAAGSGCMAAVDAERYLDSIR

    >gi|189500249|ref|YP_001959719.1| Rhodanese domain protein [Chlorobium phaeobacteroides BS1]
    MHALKEIDTGVLKDLLENKDIHLTDVRSIDAYNGWPMRGEARGGHIRGARTLPEKWLGYPEWKNILQFKHILKDDTIVVY
    GYTPEESRKTALQLVEHGFQNVSVYNGFLSEWSADDSLPMEKLANYRQLVSPEWVKSLISGAAPLEYDNDRYVVCHGHYR
    NRDAYLSGHIPGAIDMDTLALESPETWNRRSPAELKAALEQHGITVDTTVVLYGKFMHPDNADDFPGSAAGHIGAIRLAF
    IMMYAGVKDVRVLNGGYRSWIDAGFDTSTEDEPKQQVAEFGADIPARPELAVDTPEAKEMIRAEDEDIICVRSYPEYIGE
    VSGYNYIKKKGRIPGAVFADCGSDAYHMQNYRNLDHTTREYHETAAIWKHSGIVPEKHLAFY
    CGTGWRGSEAWFNALVMG
    WPNVSVYDGGWFEWSNDPDNPYETGEPKGS

    >gi|189500404|ref|YP_001959874.1| thioredoxin [Chlorobium phaeobacteroides BS1]
    MQDRAFDFGRDVQERSNEIPVLVDFWAEWCGPCRMLGPVLEKVTEHHAGEFVLVKVNTEEHPDIAREYGIMSIPAVKLFI
    RGEVADEFVGAMTERQVEDWLKKALPGKYADQLLEALSFVTQGKEDAATSILEMILKNEPANKEAAAVLLKLTIFSAPEA
    AVAMIDGLEGEYAYAELVASARTITGLLLLDTAPLPDDPVKDRYLSAIEHMRRKEFDSALVRFIEVIRQNRYYDDDSARK
    ACIAIFKYLGEDDPTTLKHRRSFDRALY

    >gi|189500418|ref|YP_001959888.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Chlorobium phaeobacteroides BS1]
    MNFDFDVIVIGGGAAGLTAAGVSASLGAKTAMIEKKKLGGDCTWYGCIPSKALLKSAKVAQTVREAEKFGIKTGNLSIDF
    EAVMKRVRSIQQDVYQEADAPEIYEAMGVTVIEGRGSFADEHSVIITKEGMDDLTLRSKNIVIATGSRPVIPPIEGLETV
    PFLTNETIFTLEKQPKKLLVIGAGPIGTEMGQAFTRLGSEVTVFDFGERILSHDHPELSALLHDMLTREGINFRLNTAVK
    KVAKKNNSIVVTAEDRNTGESFSVEGDALLVASGRKAAIETLNLEAAGIDTHKRGIRVNESCQTSRHHIYACGDVAGGLQ
    FTHMAEHMAKVAASKMLTHLPMKTDDKHVPWCTYTEPELAHVGETEETLKKNNTGYELYRFPFNRIDRAITESEKQGWIR
    VYAAGFDGRIFGVDILGVHAGELISEFALAMRNGVTLRQMSDTIHPYPTYALGNRRAADQWYVRKQSGALVGLLQFFFGY
    QGKMPDTSDPDRIV

    >gi|189500426|ref|YP_001959896.1| OsmC family protein [Chlorobium phaeobacteroides BS1]
    MLIIACSFHTVWFCCYISVWFSGENNAYSDVRFYGYLKQLLIVSDSIMNEMIISFAGGKKVNAEYRGFTIMTDQSPRSGG
    EGSAPEPFSLFLASIGT
    CAGIYVYSFCQERNLPTEKLRIVQTHHRREDGSGIGKISIDIEVPEDFPEKYRDTLVKVANLC
    AVKKHIQNPPEFEVSTSIAGS

    >gi|189500469|ref|YP_001959939.1| electron transport complex, RnfABCDGE type, E subunit [Chlorobium phaeobacteroides BS1]
    MNEALNIFTRGFVKENPVTKMLLGLCPVLAVTTTAINGLGMGLATTFVLLGSNVVIALASKAIPSTVRIPSFILVIATFV
    TIVDLLIQAFSPELNQSLGIFIPLIVVN
    CMILGRAEAFASRNGLWYSIIDAIGMGLGFTFALLLLSIFREVLGAGTIFNI
    PLVGEDASTILVFALPPGAFAGLGLIIAGLNSLEKKMGDKK

    >gi|189500470|ref|YP_001959940.1| electron transport complex, RnfABCDGE type, A subunit [Chlorobium phaeobacteroides BS1]
    MNELSGLLLVIVSAIFVNNVVFARFLGICPYLGVSRKLDTALGMGFAVTFVMTIATAIGYVLHYGILVPFKIEFMQTIMF
    ILVIASLVQLVEIVLKKVSKSLYNSLGIFLPLITTN
    CAILGVALIAIQEDYSFVTSVVFAFFSAMGFILAILLFAGIREK
    LEEADVPKPFKNVPIGFISAAILSLAFMGFSGLVK

    >gi|189500509|ref|YP_001959979.1| heavy metal translocating P-type ATPase [Chlorobium phaeobacteroides BS1]
    MSGTEGRKADSIRCDHCQLEMKPESAVTAVFNGETRSFCCHGCLGVYELIHRESLDAFYNSRCGWTPGAPERSKINPGAF
    SDSIRNSGDTLTVEMVLSGIR
    CASCVWLVEKFLMRMDGVIAARVNYATHRLVLQWDEKITSLREILEGVHAIGYTPHPYH
    QTAFNEGLKREKNDLLLRFGTAAFFSMQLMLFITALYAGFFQGIEEQYRQTFQLISWALATPVLFYSGYPFLKNAIRSLR
    NFSLNMDVLIALGSFSAYAYSIAMIFRGGEVYFDTSAMIVTFILLGRFLEAGSRVNAGNTLMTLIEMQPKEARLIRDSKE
    PEVVSLRDIVPGDSIEVLAGDKIPLDGTILEGQAEINEAMLTGESSPAFKSVGSEVYSGTIPLNGRLAVRVTCMEKDSML
    SKIIRTVEDAQARKAPIQAVADRAAGYFVPVVIFFAAVTFLYWTFASEETATALMNAVSVLVVACPCALGLATPLAILLG
    TSSAAKEGILVKGGDIFETISRTDCVVLDKTGTITRGVPAVTDVVAVNEKEDILLCAASLERYSEHPAGKAIVEASGGSF
    LAVEDFRVFPGRGVGGQVEGKSCVAGNRQFMLENNVLLSSRVEAVYEKLTRSGKTTVFLAIDQKISGVIGLIDDVREDAA
    GMIGALNRAGIRTRMLTGDVHNVAAYVADTCGIETLDAGLNPVEKAEVIKSLKSDGRVVMMVGDGINDAPALTEADTGVS
    FGYASDIAMESAGVVIMQDNLHRIALLVKGSRRCFAIIRQNLFWAFSYNLIALPLAVGGFLHPILSALLMACSSLVVVGN
    ALRLRKF

    >gi|189500551|ref|YP_001960021.1| Redoxin domain protein [Chlorobium phaeobacteroides BS1]
    MANITLKGNPVSTVGALPAAGTVAPSFTLVNKDLSEANMADFAGKRIVLNIFPSLDTPVCAASVRRFNLEASSIPDTVVL
    CISADLPFAHKRFCEVEGIENVISLSVFRSPEFGNDYGVTIVDGPLKGILSRAVVIVDNEGKVIYSEQVPEITQEPDYEA
    ALKAMV

    >gi|189500588|ref|YP_001960058.1| Rhodanese domain protein [Chlorobium phaeobacteroides BS1]
    MQEKGRVVVISIIITVFAAVTGLLFNFLNPHGIDIINGNHEKSAQFLYDREDGAVVSQEIPDVGLPAEVEKNEQPHENRE
    EVVEETRLLKDVSDPDREITEGTEDSRQAASPDVSVPVVESTEQTEKVTDDTPSSADAAEVVIQPISLSKAKEYFDRSEG
    LFVDARSEFQYYKRHIPGSLSLSASRFDAQFPDFEMNIDKDKLLILY
    CHSITCRYSDIVANKLKGYGYTNITIFAGGWTE
    WLQAGYPVQGFP

    >gi|189500619|ref|YP_001960089.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chlorobium phaeobacteroides BS1]
    MEVLEPGTPAPPFESIDQNGKTVTLEEYRGRKVILYFYPKDDTPGCTKEACAFRDNFPKFKKIGVEVLGVSIDSEKRHKK
    FVDKYELPFRLVVDEDKKIVQDYGVWRLKKFMGREYMGTARVTYLIDEHGSIQHVWPKVKPADHALELLEYIENAG

    >gi|189500759|ref|YP_001960229.1| DsrE family protein [Chlorobium phaeobacteroides BS1]
    MEKEKLVIISTVGTENPEKATLPFVLATACQSLDADVVVFLQSSGVVLAKNGEAATVNAPGLAPLKDLLDTFMELGGTLY
    L
    CSPCLKERNISMNDVVEGAEVAAAGTLASEVMSAKSVVTY

    >gi|189500781|ref|YP_001960251.1| sulfur relay protein TusD/DsrE [Chlorobium phaeobacteroides BS1]
    MKIGILLKEGPYNHQASDSAYKFAEAAIKKGHTVDAVFLYNDGVTNVTKHMDPPQDDRDIAKRWNELGEKHGVEVLACIA
    ASKRRGISDEVIIEKGEITGLGTLTDIAIRNDRLVTFGD

    >gi|189500790|ref|YP_001960260.1| Rhodanese domain protein [Chlorobium phaeobacteroides BS1]
    MVRFIELIRNCLTDIREIMPWDLVDRLKENPDLLLLDVREPCEFDAMHIRGSMNVPRGILESACEWDYEETEPELVNARE
    REIVVV
    CRSGHRSVLAAHSMQVLGYENVVSLRTGLRGWNDYEEPMENIRGEKVEEEEADNYFTATLRPDQKRPKGQGGSG
    K

    >gi|189500964|ref|YP_001960434.1| thiol-disulfide interchange protein-like protein [Chlorobium phaeobacteroides BS1]
    MLLSCIALCLLACSSPLHAGLFGDDQPVEAEAFLVGNSSGEGLLAAVHLKIEEGWHVYWKNPGEAGMPVEIVWELPEGFR
    SLPVEYPFPERFESGGITGFGYRDEVVLFSRIVPEKPSDNRIFPRSGFPLKAEVSWLSCKEVCIPGSVSLDLEADSSSQA
    NRDLAAKFLGRIPLKGDASLVVERIAAVREDGSGFLEIDFSGPDARNVKDFFPLYPEKGIDIKGTTVQGGSVQLPLSAEE
    APERLKGVVVTERSAYVVDAGVDSGEAVPASSAVSGSLPVMLGLAFLGGILLNVMPCVLPVIGLKVFSLVGSDPLASGGH
    SRKTGRVHSLVFAAGVLLSFWVLAAFVWGLQGMGQQIGWGFQFQSPVFVMFIAAIVFAFSLNLFGLFELGAPVVSGKIGS
    VALHHDVLGSFVSGVLATTLATPCTAPFLGTALGFAFVQPVWVVFLFFTVIAVGMAAPYVILAWHPAWLKLLPKPGHWMF
    VFKQLMGFILVAVVVWLAAILNAQAGSDGMFSLLLLLFVIAFCLWIVGSLTAHGASMRKQLVVWAAALVFMTGAFLILIS
    DIGSGAKQGIEADRSGLSAAGDNNGALWQEFSPSLFEELLEKKKTVFLEFTADW
    CITCKVLEASVLGNNDVVEALHRPDV
    AAVRADWTSRDDAVTALMQRFGRSGVPLFVIIPHGELDRAVVLPEVVTVDMLLRELERARE

    >gi|189501019|ref|YP_001960489.1| Rhodanese domain protein [Chlorobium phaeobacteroides BS1]
    MTSLKTRRHFPASDSALSYNRIRTTKTVLHMFMLGNLLSPSGALGATENMIEKTIPVPVISARELLVMLDAKESVILFDT
    RTEEEYEKSHIEEAVHVEPNTPTEAFIERYADTIRNTKLVFY
    CSVGQRSSEFLNRVQQKCLDAGAIACYNLRGGIFRWYN
    EGHPVVDSRGATDDIHGYNPLWGMMVEKRRK

    >gi|189501290|ref|YP_001960760.1| NADH:ubiquinone oxidoreductase, subunit E [Chlorobium phaeobacteroides BS1]
    MEQVVHLLSLAVETIFIKNILLAYFLGMCSFLAISKKVETSIGLGLAVVFVNGITVPVNWMITNYLLDKGALQWTGIAGM
    EQVDLGFLTFIVFIATIAAMVQLVEMILDKVSPTLYQSLGIFLPLIAVN
    CAILGSSLFMVEREYDLVEATVFGTSAGIGF
    FLAIVTLATMRYKLKYSDVPEGLRGLGIAMLLTGLISMAYMSFSGINL

    >gi|189501291|ref|YP_001960761.1| NADH:ubiquinone oxidoreductase, subunit D [Chlorobium phaeobacteroides BS1]
    MAIKKAFDTFAGPLAKSNPITTQVLGICSALAVTVKMDTALVMSAALIFVLVGSNTIVSALRNLIPSRVRIIVMLTIIAT
    LVICIDQILKAFLFDISKQLSIFVGLIITN
    CIVLGRAEAFALKNTIGESALDGLGNGIGYGLILLLVAAARELLGSGTML
    GIQIVPRFLYVDQGGWYVNNGFMLLAPGAFIILGLLVWVQRTITGYTEE