Chlorobium luteolum DSM 273 uid58175

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|78185914|ref|YP_373957.1| thiol:disulfide interchange protein, thioredoxin family protein [Chlorobium luteolum DSM 273]
    MKMIRRTVFLLTAALLLVVRPAATLSAEPSTAQGVKAPVFSGITLEGKRISSASLAGKPYIVNFFASWCPPCRHEIPDMV
    ALQKVYGPKGFTFIGVAVSDSEPAIRAFVSKAGITYPVMMGDEKIVGAFSGQVRGGMRSIPTSFVINSSGRITEVITGAR
    SRDEFEKKILQSFKK

    >gi|78185922|ref|YP_373965.1| rhodanese-like protein [Chlorobium luteolum DSM 273]
    MTTLSELVEECLPDVQEIMPWHLVERMAGVPGLLIVDVREPYEFEAMHIEGSVCVPRGILEAACEWGYEDTLPELAAGRD
    REIVVV
    CRSGRRSVLAAYAMQRLGFLNVRSLRTGLRGWNDYDEPLVDADGAVVGTNDADSFFLSRLRPDQMPPKAGN

    >gi|78185930|ref|YP_373973.1| DsrE protein [Chlorobium luteolum DSM 273]
    MNIGILLKEGPYNHQASDTAYKFAEAAIRKGHRIDAVFLYNDGVINATKLGDPPQDDRNIAERWSALATEHGFEVLACIA
    ASKRRGITDELMIKGGSITGLGTLTDIAIRNDRLLTFGD

    >gi|78186118|ref|YP_374161.1| bacterioferritin comigratory protein, thiol peroxidase, putative [Chlorobium luteolum DSM 273]
    MIATGTPAPDFTLPDSEGRMVSLSSFRGKKVLLVFYPGDDTPVCTAQLCDYRNNVSEFTRRGIEVLGLSADSSESHKSFA
    GRHQLPFTLLSDSEKEVATAYGAIGFLGMSQRAYVLIDEEGTVQLAYSDFLPITYQPMKDLLLKIDEA

    >gi|78186222|ref|YP_374265.1| heavy metal-binding domain-containing protein [Chlorobium luteolum DSM 273]
    MKQDVRVEGMTCGGCERSVKEALMELEGVLSAEASFLENVVRVDYDPDMISIRAIMSVIVELGFRVVP

    >gi|78186404|ref|YP_374447.1| protein-disulfide reductase [Chlorobium luteolum DSM 273]
    MKKGRERSGMFRAWSLVLLLALSGIVPAAWSALHAAGPADPSSAFRLRGELLRNGSVSLRWEIAEGYKLYGDQVRLEVDS
    GSVSMTPPVLPEGEQALDPLTGEAAAVYHDSLRLTVPFTATGSPFVLRVWHQGCADEGICYPPAATLFRIDPEKPGPLRA
    EAGSAGFGVLPASPSASFEPPSDTAPSPVMATLMEGSLWKIGAVFFVFGLLLSLTPCILPMLPILSSIIAGEASPSRSRG
    LLLALVYSAGMAVVYTGMGVAAGLAGEGLAGFLQQPPVLLGFAFLLILLSLSMFDLYQLQIPASLQKRLNSASVTLKGGR
    FPGVFLMGAISALVIGPCVAAPLAGTLIFISQTGDLLLGGMALFSMAAGMSVPLLLLGLSAGFLLPRAGGWMVAVKYLFG
    ILLIAVAINMASPVLPPPAVMTAWAMLLVLAAYFLGVFQRSGGNASSLNLAGRATGFLCLLLAAVMVFGAATGARSPGDL
    LRVLGGTAVDGRQPALQFLMISSDAELDRELRDADRPVMLDFSADW
    CVSCRELEHITFRDPEVAAALGRMRLLRVDVTRH
    TPEDRRLMKRFGVFGPPALVFFDSKGRELSGLRVDGFIAPKDLLELIRRP

    >gi|78186417|ref|YP_374460.1| rhodanese-like protein [Chlorobium luteolum DSM 273]
    MAKVKEVNPTTAFDMTKKGALIVDVREPHEVSRKAFDVADVMLAPMSRFSGSMAEIPANRNVIMACHSGSRSIIAARMLA
    EHGHKRVTNMQYGIAYWERAGLPVKKAPKKPPFVWLKKLFGKEG

    >gi|78186464|ref|YP_374507.1| peroxiredoxin [Chlorobium luteolum DSM 273]
    MSQHPEEELYYDISMPLLGDEFPELDVQTTHGPMNIPGDLKGSWFVLFSHPADYTPVCTTEFVAFQERVPEFDKIGCKLI
    GMSVDQVFSHIKWVEWIEEKLNVEITFPIVAANDRIANKLGMLHPGKGSNTVRAVFVGDPQGKVRLVLYYPQEIGRNMDE
    ILRAVTALQYSDKHKVAMPADWPNNTMLKDRVIIPPANNVADAKKRPSQYECYDWWFCHKAMEK

    >gi|78186519|ref|YP_374562.1| bacterioferritin comigratory protein, thiol peroxidase, putative [Chlorobium luteolum DSM 273]
    MTLLEPGTPAPPLYGRDQDGREVKLEEYLGKKVLIYFYPKDDTPGCTAEACAFRDNLPNFNTVGVEVIGVSVDPQARHRK
    FVDKYSLPFRLLADEEKKTVEAYGVWGQKKFMGREYMGTSRVSYLVDEQGRIEKVWPKVKAADHPLEVLEWLETKH

    >gi|78186605|ref|YP_374648.1| thiol peroxidase [Chlorobium luteolum DSM 273]
    MTDGSFLLGVFFFFKPINDLFMATITLKGNPVHTSGTLPAVGTEAPFFCLVKTDLSEAGPADFAGRRMVLNIFPSLDTAV
    CAASVRRFNQEAAALDNTVVLCISADLPFAHNRFCELEGLTDVIALSVFRSPEFGRDYGVTLTDGPLKGLLSRAVVVVDA
    DGRVAYSEQVPEIVQEPDYAAALKALQ

    >gi|78186631|ref|YP_374674.1| thioredoxin [Chlorobium luteolum DSM 273]
    MATSLEDLIRTSTTPVFVDFWAAWCGPCKMVAPSVRKLAAEFKGRLRVVKVNVDEQPAAASRFHVQGIPALMLFKDGEKK
    WSTAGAVPYPQLKAEVEKVLG

    >gi|78186657|ref|YP_374700.1| dihydrolipoamide dehydrogenase [Chlorobium luteolum DSM 273]
    MPSMNASTPLSAPRKVDVAVIGSGPGGYEAALLAARMGMQVALIEKSALGGVCVNWGCIPTKALLRSAEAFDLVRKGAAL
    GLHAPGASFELAAAVKRSRTVVLKISKGIEYQLRKAGVEVVPGEARFAGPHELDIIREGAVADTITARSIIIATGGRMRT
    IPGLEPDLRLLITSREALAMKELPASMIVLGGGAIGVELAWFYATIGTRVTIVEMMDRLMPLEDAEISEALKRSFQKAGI
    TVATGSKLEDVKREGERVTARLMVPGEEPQEIEAERLLLAVGVGGSTEGLGLEAAGVGVSRGFIETDALCRTAVAHIYAI
    GDVRGGMLLAHKASAEAAIAVASIAGTSAEPLEDTMIPRCVYAEPSIASIGMSEEQAVAAGKNVSVGRSNFAASGKANAY
    GSLEGLVKLVFEAGGGPLLGAHLIGHGAVELIGELALARSLGITASRLSSVVHAHPTLSESIREAALQALGE

    >gi|78186767|ref|YP_374810.1| bifunctional methionine sulfoxide reductase B/A protein [Chlorobium luteolum DSM 273]
    MPYNPLSPDEEQVIVHKGTEMPFTGKYYLNKEEGVYRCRRCDAPLFRSGDKFQSGTGWPSFDDAIEGAVRQVPDADGRRT
    EIVCNTCGAHLGHVFFGESMTPKNVRH
    CVNSLSLDFQPAAPAPQALQTAVFAGGCFWGVEHQLAKLNGVHSVVSGYTGGT
    KENPTYREVCSGTTGHAEAVEVTYDPAVVDYQTLARLFFEIHDPTELNRQGPDIGTQYRSAVFYRDEEQRRVALELIGKL
    KEKGYKVVTTVEKAGPFYPAEQYHQDYYQKSGHEPYCHIYQKRF

    >gi|78186971|ref|YP_375014.1| heterodisulfide reductase, subunit A [Chlorobium luteolum DSM 273]
    MAKIGVFVCHCGENIAAKVDCTKLTAAMESHPGVSIATEYKYFCSDPGQESIKKAIVEQGLTGVIVAACSPRMHEATFRK
    ACAAAGLNPYLCEIANIREQCSWVHSDGDEATEKAIEITRSLVEKVKRNNELQPILVPVTKRALVIGGGIAGIQAALDIA
    NAGGEVVLVEREASLGGHMAQLSETFPTLDCSQ
    CIMTPRMVEAAQHPNIRLLTYAEVEKVEGFIGNFHVRVKMKARYVDM
    YACTGCGDCIQKCPQKKISAEFDCGLANRPAIYTPFAQAVPNKPVIDRQHCTYFKNGKCKVCQKVCQTNAINFDMEDEYL
    DLEIGAIVVATGFQIQNTSLYGEYGYGRYPDVVTGLQFERLASASGPTGGRIARPSDGKEPETVVFIQCAGSRDPSKGVS
    YCSKICCMYTAKHAMLYAHKNHHGTSRVFYMDIRAAGKGYDEFTRRAIEEDGAGYIRGRVSKLWEENGKLMVRGVDTLLG
    RPVEVPADMVVLATAMVPQPDAKEFAKTLGIGCDEYGFFNEAHMKLRPVETATAGIFLAGACQSPKDIPDSVAQASAAAS
    KVLALFSREKLEREPIIAMNNEATCSGCWGCVLACPYNAIEKKDITDRAGNLIRRVASVNPGLCQGCGTCVTFCRSNSID
    LAGFTEKQIFAEVMGL

    >gi|78186992|ref|YP_375035.1| hypothetical protein Plut_1130 [Chlorobium luteolum DSM 273]
    MGNDMIISFGGGKKVNAEFKGFTIHTDQSPNGGGEGSAPEPFALFLASIGTCAGIYVYSFCQQRDIPTDNIRIVQSHFPK
    ESGRGIGKIAIDIQLPADFPEKYRDAVINAANLCAVKKHIQDPPVFELSTSVAGS

    >gi|78187020|ref|YP_375063.1| electron transport complex RsxE subunit [Chlorobium luteolum DSM 273]
    MNEALNTLTRGFVKENPVTKMLLGLCPVLAVTTSAVNGLGMGLATTFVLLGSNVVISLTSKMIPDTVRIPSFVLIIATFV
    TIVDMLIKAFSPELNQALGIFIPLIVVN
    CIILGRAEAFASRSGVWYSVLDAIGMGIGFTLALLVLASIREVLGSGTIFNM
    PLIGENGTPLLVFALPPGAFAGLGAMIALMNALEKKRGVN

    >gi|78187021|ref|YP_375064.1| electron transport complex, RnfABCDGE type, A subunit [Chlorobium luteolum DSM 273]
    MAEYLLVIVSAVFVNNVVFARFLGICPYLGVSKKLDTALGMGLAVTFVMTLSTAITYVLYHGVLVAFHIEFMQTVMYILV
    IASLVQLVEIVLKKVSKPLYSALGIYLPLITTN
    CAILGVALLAIQEKYSLVMSVLFAFFSAIGFILAIVIFAGVREKLED
    ADIPAPFRNVPIGLVSAAILSLAFMGFSGLVK

    >gi|78187091|ref|YP_375134.1| thioredoxin [Chlorobium luteolum DSM 273]
    MAEPVSFDFQRDVIDRSYDLPVLVDFWAEWCAPCRMLAPVLEKLAERHIGGWVLVKVNTEEYPDIASRYQIRGIPAVMLF
    SGGEVRDSFTGALAEHQIEEWLQKAVPGPYAKEVLLAEEFIREGKLSMALSVLEGVIESEPGNLKALSLLLKLKLFSAPG
    YVLALSPKLDAEVEYMELAGTLKTLSRLLDASLSAFPEDDLRADYLAAIECLRREDFDGALKGFIDVLRRNRGYDDDGSR
    TACIAIFRFLGEEHEVSIRHRRSFDRAF

    >gi|78187092|ref|YP_375135.1| copper-translocating P-type ATPase [Chlorobium luteolum DSM 273]
    MSCASCANIVQKKLTAMEGVEGADVNFATEKATVELSDGAPRLEAMNSQLEKLGYRLMEEETEPGMETTDRTHAGAPEER
    KAGEEKLKSLRAMKRTVLLVLPPAILMVAVMLYGMLVRPLPHDIYNPVAMIIATIILFGPGKPFLKGVSAFVRYRAATMD
    TLIGIGTLAAYTYSSAITLFPSVREFLQVDPHTYFDTAVIIIGFVLSGKYLEARAKQKTGEAIEKLIGLQAKSAIIVRDG
    TEMTVPVSEVRRGNLLRVKPGAVIPVDGIIAKGTATIDESMVTGEPVPVDKAPGEEVIGGTINKQGSFTFTAMQVGSNTM
    LSRIIAMVEEAQGSRAPIQNMADRVASVFVPLVLLFALLTLLLWLFIGSLTMGFAAALPLAINSFIGILVIACPCALGLA
    TPTAIIVGVGRGAENGILVRNAEALEKLAAADTVVFDKTGTLTSGRPVVTDIVALNAEPERSHILQLAASVEALSEHPLA
    RAIVEAAEQQQLQLLESPEFKSMEGFGVSALLEGKRVQVRKPTVEESALPSASSLLAEGKTLAIVDVEGSAVGMVALADT
    MKENARDAVEALKRQGVKVIMMTGDRVEAAEWIARQAGIDTVMAGVPPEEKAERIRELQREGRRVAMAGDGINDAPALAV
    ADAGIAMATGTDIAIAAAGITLLKGDIMKVTEAVQLARATLRVVRRNLFWAFFYNIVGIPLAAGAFYPLFGLLLNPAFAG
    MAMAGSSVSVVASSLWLKRMRIR

    >gi|78187122|ref|YP_375165.1| thioredoxin reductase [Chlorobium luteolum DSM 273]
    MEGDVRDIVIIGTGPAGYTAAIYTGRANLKPLVIDGYQPGGQLMITSEIENFPGFPEGIQGPELMQRMRDQATKFNAEFK
    FGSVTEADLSRRPFSLTLEDGSEILTRALIIATGANAKWLGIESEDRYRGRGVSA
    CATCDGFFFRDSTVFVIGGGDTAME
    EALYLTKFASRVVLVHRREEFRASKIMSLRASKNPKIDTMLNVVVDEILGDGQKVTGIRLKNVKTGELEEHACDGVFMAI
    GHAPNAKMFEGQLDIDDYGYILTKKSSTETSVQGVFACGDVQDFIYRQAVTAVGTGCMAAVDAERYLETIR

    >gi|78187123|ref|YP_375166.1| thioredoxin [Chlorobium luteolum DSM 273]
    MSGKYLVATDQNFKAEVLESGKVALVDFWAAWCGPCMMLGPVIEELAGDYEGKAVIAKVNVDDNPNTAAQYGIRSIPTML
    VFKNGQVVDQMVGAMPKNMIAKKIDEHIG

    >gi|78187352|ref|YP_375395.1| thiolredoxin peroxidase [Chlorobium luteolum DSM 273]
    MGVLVGRKAPEFNVEAVAGGREFVDSCKLSDFSGKYVILFFYPLDFTFVCPTELHAFQEKLDEFKKRNVEVIGCSVDSKF
    SHFAWLQTPRNRGGIEGVTYTLLSDLNKTVSTDYDVLAEGAGVSLRGLFLIDKAGIVRHQVVNDLGLGRNVDEVLRMVDA
    LQFTEQFGEVCPANWNKGDKAMKPTDEGLKDFFKDE

    >gi|78187422|ref|YP_375465.1| protein-disulfide reductase [Chlorobium luteolum DSM 273]
    MQRERIIKNEHRHVRWLTMALLVLSSMLPQRVFASDFLDPDQAFKLKATLTDSNMVVLDWDIANGCKLYRDRITVNVGSG
    SATLQEPVLPKGATITDEVTGEALEIYHDHLKVVVPIVSADAPFRLDVAYQGCADAGLCYPPLTRMYLVEQGRPGLLAES
    VDDGGTGDPSESAASSEQAPAIAGGASSGSDDMSLAKATLEGGSLWKIGLAFLVFGLLLSFTPCVLPMVPILSSIIVGEG
    TVSRRHGFLMAVAYCLGMAFVYTSLGVAAGLAGEGLAGALQKPWVLVTFAALLVLLSLSMFDVYQLQMPQSLQTKLGRAS
    DCLKGGRFAGVFVMGSLSALIVGPCVAAPLAGTLVYISQTGNVVLGGLALFAMAMGMSLPLLLVGLSAGALLPKAGAWMI
    SVKYLFGLMLIAVAIWMVTPVLPPTVIMVVWGAFAILCAVFLGVFGAMPEKPSIGRRFSKALGVVLIVIGVMELFGAASG
    GERPLEPLSEIRPARASVGIRESKPLFRRITSVAELDEVLRSADQPLMLDFYADW
    CVACKEMDRFTFHDPAVMNRLQDFT
    LLQVNVTANTLEDRALMKRFSLFGPPGIIFFDRFGHELPDRRIVGVMDAPAFLQHLQGIMKP

    >gi|78187426|ref|YP_375469.1| hypothetical protein Plut_1572 [Chlorobium luteolum DSM 273]
    MRHMEKLLEAYLYAVFQKKNCIPMMNRQCKRLRRFAFAALMTMSFTGNALALDAGQRAVDFSLPGTQGPVSLADRAGSVV
    YVDFWASW
    CGPCRESFSWMNSMQQKYRSKGLRVIAINLDARRADAWKFLAEHPAAFTVAFDGTGKTPDIYGVKGMPTSFL
    VGRDGKIVLRHTGFKASDRQQLEKQIQAALEGGK

    >gi|78187559|ref|YP_375602.1| redox-active disulfide protein 2 [Chlorobium luteolum DSM 273]
    MIQVKILGTGCAKCNQLADAVKALIAADSIVAEVEKVEDIQKIMSYNVLSTPALVVDGEVRASGRVPSADELRSLLSPKA
    KGCCCKGSSGSSCC

    >gi|78187639|ref|YP_375682.1| hypothetical protein Plut_1785 [Chlorobium luteolum DSM 273]
    MPRTVTIYGRPECCLCVEAMEVLLSVQKEVPFTIEKKDITEDPVLESRYRFSIPVIHIDGAFAFKHRVTAVDILSRLRD

    >gi|78187793|ref|YP_375836.1| NADH oxidase, putative [Chlorobium luteolum DSM 273]
    MQKSVDVLVIGGSAAGIAAATTGKAFYAAKSFLIVRKEAEAVVPCGIPYVFGTLQGIEQNVIPNAHIEGAGVELLIDEVV
    SLDRSTKTATTANGVTITFDKLVIATGSLPRVPGWLKGRDLQNVFTIPKDRNYLADVRRRLESCERIVIIGGGFIGVEMA
    DELSKKGKQITLVEVLPHVLSLAFDSDLSLQAEGILRDRGIVLRTGEKVHELAGENGKVSRVLLESGDSVPADAVILATG
    YAPNVTLAEKAGIKINELGAIRVDEYMRTEDKDIFAVGDCAEKFSFITRIVKGLMLASTAVSEARIAGMNLFGLSRLRTF
    GGTISIFSTAIGGITFAAAGVTECLAKERGFDVVSAGFEGIDKHPKSMPGTATQFVKLIVNRESGLVLGGAVTGGNSAGE
    LINVIGVIIETKMTINELLTLQFGTHPLLTGPPTGYPLLKAAEAVEIKLRHLDRCAEKQS