Chlorobium limicola DSM 245 uid58127

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|189345569|ref|YP_001942098.1| Flavocytochrome c sulphide dehydrogenase flavin-binding [Chlorobium limicola DSM 245]
    MSQKFSRRDFNKLLVSGVAGSAFGIFGAVRPAYAAQNRIVVIGGGFGGASAAKYLRKLDPSLSVTLVEPKATFYTCPFSN
    WVLGGLKNMEDIAQTYTVLKNKYGVNVIADYASSIDAAKGTVTLKSGKVLNYDRLIVSPGIDFKWNTIEGYSESVSNTKM
    PHAYEAGPQTVLLHKQLLAMNDGGTVLICPPANPFRCPPGPYERASLVAHYLKEKKPKSKIIILDPKDKFSKQGLFKKGW
    EKLYPGMIEWRSVATGGKISKVDAATMTVTTDFGVEKGDVINIIPPQQAGKIAVDAGLTDASGWCPVNPITFESTIHPGI
    HVIGDACIAGAMPKSGFAASSQGKVVAASIIRLCQGKVPAPPSLVNTCYSLIGPGYGVSVAGVYKLTSAGIVEIPGSGGL
    TPMDADDDHLNEEATFARGWYNNIVQDIWG

    >gi|189345588|ref|YP_001942117.1| Redoxin domain protein [Chlorobium limicola DSM 245]
    MRTMIRTAKGQMIPFIAALLLFLAFPAVQAAEKVPAPAFSAVAVDGKAVSSRQFAGKAYIVNFFASWCPPCRSEIPDMVA
    LQKAYRAKGFTFIGVAVSENDDSIKSFMKSTGINYPVIMADQKLINAYGRYVEGGIRSIPTTFVVNRAGQITQVITGARS
    KAVFEKVILDAMKPAKAVK

    >gi|189345621|ref|YP_001942150.1| methionine-R-sulfoxide reductase [Chlorobium limicola DSM 245]
    MLMFIFFATVGLFACSGEPTSPKFSPSKAMSDSRALNPYYSRTDTTKLDLPDSVWKKVLPPEVYEVARKAGTERAFTGKL
    WDFEGIGTYYCAACGNVLFRSDAKFASTCGWPSFFETVRPGSVEYRTDMAFGMARTEVLCGRCDAHLGHVFDDGPPPTGK
    RF
    CMNSIVLDFEPDEGD

    >gi|189345756|ref|YP_001942285.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Chlorobium limicola DSM 245]
    MKSVDVLVIGGSAAGIVAASTGKAFYPSKSFLIVRREREAVVPCGIPYIYGTLDSITQNIIPNAHIEQAGVELFINEVTA
    IDKSAKVVTTADGTEIAFDKLVIATGSMPRVPSWLKGTDLGNVFTIPKDRDYLENLRLKLEQCTNIVIIGGGFIGVEMAD
    ELRKKGKRITLVEVMPHVLNAAFDDDLSVKAEKILADNGVVLRTGEKVGELIGDGVVSGVLLENGELLDADAVILATGYA
    PNVDLARNAGIKINELGAIRVDEYMRTEDKNIFAVGDCAEKFSFITRIVKGLMLAATACSEARIAGMNLYGLSRLRTFSG
    TISIFSTAIGGTTFAAAGVTEHLALDRGFDVISASAEGIDKHPKSLPGTSSQFVKLIVNRESGLVLGGAVVGGVSAGELI
    NVIGVIIENKMTIHEVLTLQIGTHPLLTGPPTGYPLIKAAEAVIKKLRSSH

    >gi|189345840|ref|YP_001942369.1| glutaredoxin 2 [Chlorobium limicola DSM 245]
    MNRLHTVTLYGKKDCCLCDQAMTVLYKVQASVPFVLEKVDLASQPDLLEKFGEQIPVIFVDGVPAFRYRVREDRLAALLA
    EPAH

    >gi|189346022|ref|YP_001942551.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chlorobium limicola DSM 245]
    MSEHFEDQFYYNEANMPLLGDEFPEMKVQTTHGPMNIPGDLKGSWFVLFSHPADYTPVCTTEFHAFQERMADFDKLGCKL
    VGMSVDQVFSHIKWVEWIKDNLDTEITFPIVAANDRIAMQLGMLHPGKGSNTVRAVFVGDPEGKVRLILYYPQEIGRNID
    EIVRAVKALQVSDANKVAIPANWPINTLLKDRVIIPPANNIEDAKKRPSQYDCYDWWFCHKAL

    >gi|189346030|ref|YP_001942559.1| Rhodanese domain protein [Chlorobium limicola DSM 245]
    MNQQIAKSDTMNNIKNITPAAAFAMTKKGALFVDVREPREIARKAFDVPDIMLIPLSTFEQRFQEIPVNRNLIIVCNSGN
    RSLTAGRLLLNRGYRKVVNMQYGIVGWDKEGLPIKRKPQRNLWSLLLQMFRNMS

    >gi|189346224|ref|YP_001942753.1| Rhodanese domain protein [Chlorobium limicola DSM 245]
    MLTFNSLIDNCLGDVREIMPWDLASRMEVNPDLLLLDVREPYEFDAMHIRGSINVPRGILESACEWDYDETVPELAAARQ
    REVVVI
    CRSGRRSVLAVAAMQQLGFEDAVSLKTGLRGWNDYEEPLVNLTGEVVDSDLADDFFTPKLRPDQRRPTVQTQ

    >gi|189346232|ref|YP_001942761.1| sulfur relay protein TusD/DsrE [Chlorobium limicola DSM 245]
    MKIGILLKEGPYNHQASDTAYKFAEAAIRKGHTVDAVFLYNDGVINVTKLMDPPQDDRQISSRWNELHKEHGVEILACIA
    ASKRRGISDEVLIDGGEITGLGTLTDIAIRNDRLLTFGD

    >gi|189346296|ref|YP_001942825.1| amine oxidase [Chlorobium limicola DSM 245]
    MNRFGQTGAGHIIIIDYYIMSERTDVVVIGSGIGGLTAAALLQERGIQTVVFEKNAFPGGSCSSFCRNGYTFDAGASVFY
    GFSENDRSGTLNLHTKIFRKLGVEVATVPDPVQIHYHLPNGFNVAASYSRQGFLDSLAARFPHEKKGIEAFYRELEDVYE
    ILSSLPAGSLEDVVHLISVGGRFPQKTVMLALKTFRSMGKTARKYISDEELLHFIDIESYSWAVQDALSTPLVNAGICLA
    DRHHGGINYPLGGAGSIPDALCRGLEKFGGSIRYRSGVDEILVENGVARGVKLSNGETVHAKAVISNATVWDTYNRLISD
    SRYRVDDDRFIRAPSWFQMYLGVDERVIPRGFHVHHILVDDWQTYSDLGGTIYFSAPTILAPSLAPPGKHIVHAFVTSET
    SEWEQYERGGEAYREAKERYADSIIARTEKILPGLSKAVELRILATPQTHERYLNRYKGTYGAQLKPGQNILLKPQNRTP
    VRNLFAAGDSTFPGQGVIAVTYSGVSCASLVARKLGKPMDYL

    >gi|189346306|ref|YP_001942835.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chlorobium limicola DSM 245]
    MALLEIGAEAPPITADDQYGKPVTLDAYRGKKVVLYFYPKDDTPGCTKEACAFRDNLPKFQETGIEVLGVSIDSKAKHSK
    FAEKYDLPFRLVADEEKRVVEAYGVWGKKKFMGKEYMGTNRVTYLIDEQGMIEKVWPKVTPAVHAEEILDYLGQQT

    >gi|189346343|ref|YP_001942872.1| thioredoxin [Chlorobium limicola DSM 245]
    MSGKYLAATDQNFKTEILESDKVALVDFWAAWCGPCMMLGPVIEELAGDYEGKAVIAKVNVDENPNTAAQYGIRSIPTML
    VFKNGQVVDQMVGAMPKNMIAKKIDEHIG

    >gi|189346344|ref|YP_001942873.1| thioredoxin reductase [Chlorobium limicola DSM 245]
    MEKEIRDVVIIGTGPAGYTAAIYTGRANLKPLVIEGVQPGGQLMITTEIENFPGFPDGINGPELMSRMRQQAERFNAEFA
    YGSVVEADISRSPFSLTLDDGREIVARSLIIATGANAKWLGIASEDQYRGRGVSA
    CATCDGFFFKECNVFVVGGGDTAME
    EALYLTKFASKVTLVHRREEFRASKIMSLRAGKNPKIATILNVVVDEILGDGSKVTGIRLKDVRTGELIDHVCDGVFVAI
    GHAPNAGLFNGQLAIDDYGYIETKKSSTETSVQGVFACGDVQDYTYRQAVTAVGSGCMAAVDAERFLESIR

    >gi|189346362|ref|YP_001942891.1| Redoxin domain protein [Chlorobium limicola DSM 245]
    MLKHHFLMATVTLKGNPAETSGELPAIGSDMPFFCLVKTDLSEAGPADYEGKRLVLNIFPSLDTAVCAASVRRFNQEAAS
    FDNTMVLCISADLPFAHKRFCETEGLNNVVSLSVFRSPDFGKEFGVALETGPLKGLLARAVVIVDNEHKVVYTELVREIV
    EEPDYNAALKALA

    >gi|189346391|ref|YP_001942920.1| thioredoxin [Chlorobium limicola DSM 245]
    MSQSLNDLIQSSAVPVFVDFWAEWCGPCRMVAPSVKKLAEEFKGRLTVVKVNVDRQPAAAAQFQVQGIPALMLFHKGKLV
    WRTAGALSYQQIREEVVKVLGG

    >gi|189346408|ref|YP_001942937.1| heavy metal translocating P-type ATPase [Chlorobium limicola DSM 245]
    MDEKTYHVKGMHCASCAAIITKKLSQTPGIEKVEVNLATEQAKVSFREHDLSDSEINDIVGKFGYKLTSKEDGDAGTGGI
    PAEIKGRDPDTKAFSEKQEQVKQLKRLVSFSLPAAMAVFFFMMWDIASTALHSMPHMPISMEVFNGLTMILAAIFIVRIG
    KPFLDGILLFIRHGAANMDTLIGIGTLSAFTYSSLITIFPSFRNMLGLPSHTYFDVSIVVIGFVHLGKYLEARSRLKTGE
    AIGKLVGLQAKSALLVRKGEEIEIPVEKVKKGNLLLVKPGAVIPVDGIIANGSSSIDESMVTGEPLPVDRKEGDPVIGGT
    INRQGSFTFTALKVGSDTLLARIISMVEEAQGSKAPIQNIADRIASIFVPAVLVIASLTLIAWLTIGTAFLGFPAALSYG
    IMGFTGVLVIACPCALGLATPTAIIVGIGKGAEYGMLIRNAESLERLSSVDTVVFDKTGTITRGLPEVTDTGSLDGNSSP
    DELLLLAAAVERYSEHPLAGAIVKAARAKGAALPEITAFEAMEGIGVRANIGELSVTVRKPGAEENGLPVVQTLLHQGKT
    VIVIEKGNTASGFLALSDTIRNGAKEAVAELRRKGIRIIMLTGDNPSSAGYIAAQAGIDEVIAGVLPDEKAEKIAALQKE
    GRTVAMAGDGINDAPALARADVGIAMATGTDIAMESAGITLLKGDIRKISQAITLSKSTMRVIRQNLFWAFIYNIIGIPL
    AAGALYPLFGIFLNPVFSGIAMAGSSVSVVSNSLRLKTKKLH

    >gi|189346430|ref|YP_001942959.1| Thioredoxin-disulfide reductase [Chlorobium limicola DSM 245]
    MQTGLYDVIIIGGGPAGSSAALYTSRAVLKTLVIDKDPHAGALGMAHHIANYPGIPDSLSGMELLELMKRQAVSFGAEYV
    RDKVTGIDPDGAEKAVFTVSGKYYRAKTLILATGAMGKSSEIPGEKQLVGMGVSY
    CATCDAAFYRGKVVAVYGKNRETVE
    EAIVLTRFAEKVIVLCSAEKFSVSEEEVAMLHQAGNVEIRYDSKVLAVNGVKEVESLTLQGAGEPLVVDGFFIYLSGSSP
    VLDFIGGRLAVSQCGCLKIDSFYATSAPGVFAAGDMLCKEIKQAVIVAAEGCQAALYADRYLRGGRKPKHDYR

    >gi|189346444|ref|YP_001942973.1| Radical SAM domain protein [Chlorobium limicola DSM 245]
    MTIHPSLHKRKNPLAESGEQIRVLEKTDCSIPPFGSKLAETGNGPLRPDGTAILQVNIGYRCNLLCRHCHVDGGPDRSET
    MSRETMQHCLDALSKSRIQTLDITGGAPEMNPDLPWFIREARKIMPEGEILVRTNLVILVSGEEYRHFPELFRENRVSLI
    ASLPCYTRENVDAQRGKGVFDRSIEALRMLNATGYGKDGSPLQLNLVFNPGGPSLPGAQQALEADYKSRLRQEFGIEFSH
    LYTITNMPVSRFLESLLEEGGFCRYMNLLESHFNPEAVKNLMCRNTVSVGWDGALYDCDFNQMLKLPMREPAPRTISDFD
    EALLHDRTIAIGQHCYGCTAGAGSS
    CQGCLL

    >gi|189346510|ref|YP_001943039.1| electron transport complex, RnfABCDGE type, A subunit [Chlorobium limicola DSM 245]
    MTEYLLIIVSAVFVNNVVFARFLGICPYLGVSKKLDTALGMGFAVTFVMTISTAITYVLYYGILVPYKIEFMQTVMYILV
    IASLVQLVEIVLKKVSKSLYSALGIYLPLITTN
    CAILGVALLAIQEKYSLLLSVLFAFFSAVGFILAIVIFAGIRERLED
    ADIPKPFKNVPIGLISAAILSLAFMGFSGLVK

    >gi|189346511|ref|YP_001943040.1| electron transport complex, RnfABCDGE type, E subunit [Chlorobium limicola DSM 245]
    MKESLNILTRGLVQENPVTKMLLGLCPVLAVTTSAVNGLGMGLATTFVLLGSNMVISLTSKLIPDTVRIPSFVLIIATFV
    TIVDMLIKAFSPELNQSLGIFIPLIVVN
    CIILGRAEAFASRSGLWYSMLDAIGMGAGFTLSLLLLSSIREILGAGTIFNM
    PLVGEDASTILVFALPPGAFASLGAIIALMNALEKKKGAAA

    >gi|189346612|ref|YP_001943141.1| thioredoxin [Chlorobium limicola DSM 245]
    MTTDKVDFQCDVLEQSHDLPVLVDFWAAWCAPCRMLAPVLESLAEKHAASWKLVKINTEEFPDIASRYDVKSIPSVKLFV
    NGEVVDEFSGALPEYQIEQWLKNAIPSPYAKEVALAEDFFRQGKNGMAVSLAEGVLQKEPDNRKAIALFLKLRLFSNPED
    SLRLSRRLEGEAGYADITEAAQMICRLLMLPKQDLPEHPVRDLYVDAISKLAEENFDAALAGFIAVIREHRYYDDDSSRK
    VCIAIFKYLGEEHEITLRYRKLFERSLY

    >gi|189346668|ref|YP_001943197.1| Rhodanese domain protein [Chlorobium limicola DSM 245]
    MQNKNFRAPQSEAIGILYKLIETGSKHKNMYDHTEITTDSLLALLGSEKVKIIDVRSADAYNGWRMRGEVRGGHIKGAKS
    LPAKWLTDPEWLNIVRFKQIRPEDAIVLYGYTPEECEQTATRFKENGYNNVSVFHRFHPDWTGNDAFPMDRLEQYNRLVP
    AEWVNGLISGEEIPEYDNDTFIVCHAHYRNRDAYLSGHIPGATDMDTLALESPETWNRRTPEELKKALEEHGITASTTVV
    LYGKFMHPDNADEFPGSAAGHIGAIRLAFIMMYAGVEDVRVLNGGYQSWTDAGFAISKDDVPKTTVPEFGAPIPSRPEFA
    VDIDEAKEMLQSEDSDLVCVRSYPEYIGEVSGYNYIKKKGRIPGAIFAECGSDAYHMENYRNHDHTTREYHEIEDIWAKS
    GIIPKKHLAFY
    CGTGWRGSEAWFNALLMGWPRVSVYDGGWFEWSNDPENPYETGVPK

    >gi|189346717|ref|YP_001943246.1| 4Fe-4S ferredoxin iron-sulfur binding domain protein [Chlorobium limicola DSM 245]
    MAKIGVFICHCGENIGAKIDCTRLTSAMNDHPGVSVSVEYKYFCSDPGQENVKKAIREHNLTGVVVAACSPRMHEATFRK
    ACAEAGLNPYLCEIANIREQCSWVHTDQDMATEKAIEITRSLIEKVKLNNELQPIEVPVTKRALVIGGGIAGIQAALDIA
    NAGQEVVLVEREPSLGGHMAQLSETFPTLDCSQ
    CIMTPRMVEAAQHPKIRLLTYSEIEQVEGFIGNFKVRIRQKSRYVDM
    KACTGCGDCIQKCPQKKISDEFDCALGKRPAIYTPFAQAVPNIPVIDKEHCTFFKNGKCKVCQKVCETNAINFEMQDEFL
    DLEIGAIVVATGFQIQNTAMYGEYGYGKYADVITGLQFERLASASGPTAGKILRPSDGKEPQTIVFIQCAGSRDPSKGVK
    YCSKICCMYTAKHAMLYAHKVHGGKAHVFYMDIRAAGKGYDEFTRRAIEEDEAAYMRGRVSKVWLESGKLMVRGVDTLLG
    KPVEIAADMVVLATAITPQPDAREFAKVVGIGCDEYGFYNEAHLKLRPVETATAGIFLAGACQSPKDIPDSVSQASACAS
    KVIGLFSRDQLEREPVIAINNESTCSGCWGCALACPYSAIEKKDILSRSGELIKQVAFINPGLCQGCGTCVTFCRSNSID
    LAGFTEKQIFAEVMGL

    >gi|189346828|ref|YP_001943357.1| Protein-disulfide reductase [Chlorobium limicola DSM 245]
    MPVNRNIMLHRTISISGFLLFWLIAFSSNGFGTAFLDPGQAFRLKAELTSSGSVVLDWAIADGYKLYRDQVKVSLEKGDA
    ELRIPGLPAGESVTDPSTKERMEVYHDNLRIEVPVVRAAGEFTLKVVYQGCAEDGVCYPPFTRTVTIDPAKPGVLNVVED
    PETGGFGGFAVTEDVPVDSLPAAREKKAGDDFSYSQSLLKSRSLLKIGFFFLIFGLALSFTPCILPMIPILSSIIVGDGC
    YGRGRSFMLAVAYSLGMALVYTLLGVAAGLAGEGLAGALQQPWVLGMFALLLVVLALSMFDVYQLQIPGIMQSSIAKTCG
    KLKGGQIAGVFLMGSLSALIVGPCVAAPLAGTLVYISQTRHVVIGGLALFSMAMGMSMPLLLVGLSAGTLLPKAGAWMNG
    VKYLFGLMLIGVAIWMVSPVIPGPLALLFWGALAMLCAVFLHLFDSLPEQSSIAMKFGKALGIVLLVIGILELAGAAAGG
    TNPLEPLAPFGSGAGGRTSAEEAGLKFTRIRSYAELDAALASAEKPVMLDFYADW
    CVSCKELEHFTFNDPAVCKQLETMT
    LLQVDVTANTPDDIALMKRFGIFGPPAIIFFDASGNEIPGSRVVGFVEAKPFLDHLDLYLTRNLP

    >gi|189346829|ref|YP_001943358.1| Redoxin domain protein [Chlorobium limicola DSM 245]
    MQLFRSILIAGALAITMHALPALDAVAKKPVRKTALKTWLAPEFSAKSVQGGAVSSRTLAGKGYIVNFFGSWCPYCRKEI
    PDMAALQEKYEKKGFTFIGMAYRDNEQSMPDFIREQGINYPVVMADEAILDSFGRHVSGGVRSVPALFAINRDGRLLSVI
    IGAQTQEEFERIITETMKKPVR

    >gi|189346881|ref|YP_001943410.1| peptide methionine sulfoxide reductase [Chlorobium limicola DSM 245]
    MSICIVNGLRNRHSNRSFFFSFLVLLLLASCSGNAVPVPEVHHKEQKEKDMPYNQLTPEEERVIVHKGTEPPFSGKYYLN
    REKGTYHCRQCDAPLFSSADKFESGTGWPSFDDALPGAVKEVRDADGRRTEIVCANCGAHLGHVFFNEGMTGKNVRH
    CVN
    SVSLNFQPEAQKPPATRTAVFAGG
    CFWGVEYHFSNVKGVLAVKSGYTGGETSNPSYKQVCSGRTGHAEAVEVEYDPALVS
    YETLAKLFFEIHDPTQVNRQGPDAGTQYRSAVFYADEEQRQVAARLIAELKAKGYLVATTVEKAGTFWPAEDYHQDYYKK
    TGHQPYCHIYTKRF

    >gi|189346882|ref|YP_001943411.1| protein of unknown function DUF255 [Chlorobium limicola DSM 245]
    MIHESRQPNLLAKEKSPYLLQHAFNPVDWQPWGPEAFRKSRERNKPIFLSVGYATCHWCHVMERESFENEETARLLNGSF
    IPVKVDREELPDLDRLYMTYVQASTGRGGWPMSVWLTPDLKPFYGGSYFPPEDRYGMPGFRTVLTSIAQLWNTDPARITE
    ASRIFFEQLQSSSPMGKSGLPEKGEAQEACFRWLASAYDPLRGGFGGAPKFPRPALLTFLFSHAFHTGNREAASMALHTL
    KKMAEGGIHDHVHSMGKGGGGFARYSTDERWHLPHFEKMLYDNAQLAASYLEAFQISGETLFARIAEDIFNYILHDMQSP
    EGGFYSAEDADSFPDGETQEKREGAFYVWSWKEVMSLPAEPDKLELFARTYGMKPEGNVSEDPHGEFGGKNVLMEQSAPE
    KHEKDTVAALDEVRQLLYEKRLQRSRPLLDDKIITSWNGLMISAFAKGYRVLGHEEYLRAARNAADFILVHLYEENEGRL
    LRRYRDGDAAITGKAEDYAFFVRGLIDLYQACFDNRYLDAADRLCETCNRLFYDHADGGYFSTATDDNTVPVRLKEEYDG
    AEPAASSVGILNLLDLAVMTGNEAYEGMAEACFRGFGTMLSHNSPALPLMLAALNNARKGGILAVLAGNMQSPRMQELLK
    TLNSRYLPGLTLMHHASAGSLKGSEIPADIDPESAIPAVYLCIGHACRLPATTPEALDELLDGTIR

    >gi|189346889|ref|YP_001943418.1| dihydrolipoamide dehydrogenase [Chlorobium limicola DSM 245]
    MRWKTLRVSSSIFKRKHIMTRKFDILVIGAGPGGYIAAIRAAQLGFSVACCEFNAYDSPEHEPRLGGTCLNAGCIPLKAL
    VASSEAYEKTAHSLSSHGITVNGVTIDVARMQQRKEEIVTRMTGGIQFLFRKNKITLLKGQASFAGKTETGFRITIGGND
    GKEDVVAQKVIIATGSKARHIPNVRVDNVTI
    CDNEGALKFTEAPKKLGVIGAGVIGLELGSVWRRLGAEVTVLEVMPSFL
    GSADESVSREAAKLFLKQGLRIKLGVRIGQAKLTEQGISIAFTDDQGAEHLLECDKLIVSVGRVPNTDHLNLEAVGLQTD
    ERGFIPVNDHCATAAPGIFAIGDVVRGPMLAHKAEDEGVMVAELLAGQKPHIDYNTIPWVIYTTPEIAWVGKTEQQLRSE
    GHDYKTGMFPFAANGRALGLGDVEGFVKMLADGKTDEILGVHIIGANASDLIAEAALAMEFRASSEDIARTCHPHPSLSE
    AIREAALAIDKRALNM

    >gi|189346939|ref|YP_001943468.1| OsmC family protein [Chlorobium limicola DSM 245]
    MSKDMIITFEGGKKVNAEFKGFTIETDQSEYAGGEGSAPEPFMLFLASIGTCAGIYVYSFCQSREIPTEGIRIVQSHFPK
    ENGKGIGRIVLTIEVPPDFPEKYRDAVVNAANLCAVKKHIQDPPVFEVVTATTGK

    >gi|189346945|ref|YP_001943474.1| methylated-DNA/protein-cysteine methyltransferase [Chlorobium limicola DSM 245]
    MIISFQQTPIGRIGITEYEGAITNLCFEHYPVPDGARPGDTVLLRDAFRQLQAYFQGDLRVFDLPLDPRGTPFMNEVWRH
    VAAVPFGRTASYRDIAMAAGNLKAVRAVGMANRRNPLPVFIP
    CHRIIGSDGKLTGYRGGLPLKLRLLDHERCVFFRS

    >gi|189346953|ref|YP_001943482.1| Rhodanese domain protein [Chlorobium limicola DSM 245]
    MFGSDRLLDGAIMMIERTHRTENLATDELAAMLAGPAPPLLFDIRKAEEYGKSHIETAIRIEPDTGPDDFAARYAAIMAG
    RDTVFY
    CSVGQRSSELLERVESACGKAGAKSCRNLRGGIFRWYNEGRPVVDASGPTDDIHGFDPIWAMMVARRR

    >gi|189346996|ref|YP_001943525.1| dihydrolipoamide dehydrogenase [Chlorobium limicola DSM 245]
    MQDKMEKRAYDADLAVIGSGPGGYEAALRAARLGMKVILVEKGSPGGVCVNWGCIPTKALLRSAGMFDDLSKASGYGVLL
    SDPGFDLAQAVKRSRNVALKLSKGIGFMLKKAGVEYRHGEARLSASHEISVIRDGEQVGSFTSENIIIATGGRFRELPGL
    VPDGRRIITSREALALKDVPRSMLVLGGGAIGIEMAWFYAKAGTKVTVVEMMPQILPLEEAEIAEGLRRSFEKAGIEIHT
    SAKLEQLSCRESGVEAVIRKQGEDPLPAEADCLLVAVGVTGNADGLGLEEAGVEISKGFILTDDQCRTAADHIFAVGDVR
    GGMLLAHKASAEAAIAVAAIAGKPLPALDDTKIPRCVYVEPSVASVGLTEELAKAKGCKVTIGRSMFAASGKANAYGNLE
    GLVKLVFNASDLRLLGAHILGHGAVELIGEIGLARHLEVTAGDIAHAVHAHPTLSETIREAAEYALDTQVSEG

    >gi|189347143|ref|YP_001943672.1| nitrogenase-associated protein [Chlorobium limicola DSM 245]
    MAAILFFEKPGCRNNAKQKSLLELSGHHVEAVNLLDYPWTKEELSCFLGEKPLAACFNPAAPSVKSGETEPHAYSRNEAI
    DAMIRNPILIKRPLMKIGTRCIQGFDTAVLRNFISLVPLPGAESVVKSITMTDMDACPHIADFSCTNQNH

    >gi|189347189|ref|YP_001943718.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chlorobium limicola DSM 245]
    MGVLVGRKAPEFNVEAVTGGSQFVDSCKLTDYRGKYVVLFFYPLDFTFVCPTELHAFQEKLDEFAKRNVEVIGCSVDSKF
    SHHAWLRTPKNLGGIEGVTYTLLSDINKTVSRDYDVLAEDAGVSLRGLFLIDKEGVVRHQVVNDLGLGRNVDEVLRMVDA
    LQFTEEFGEVCPANWNKGDKTMKPDDAGLKAFFSE

    >gi|189347210|ref|YP_001943739.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Chlorobium limicola DSM 245]
    MTLNKVYYSGGEEIRDLTIVGGGPTGIFAAFQCGMNNITSRIIESMPQLGGQLAALYPEKHIYDVAGFHEVPAAGLVDSL
    WKQAERYHPEINLGEAVTRYRKLDDGSFETTTKSGKVFLSRALLLAAGLGAFTPRTLPQLGCVDHLEGRSIFYAVKNIRD
    FAGKKVVIVGGGDSALDWAVGLLDAAEHVTLVHRMHEFQGHGKTAREVDEARDKGVIDVYMDTEVTAIETAEGGMKNVTL
    LRKNGASVVLEADRLLILIGFRSNLGPLAEWDLELVDNALVVDSHMKTSVDGLYAAGDIAWYPGKLKIIQTGLSDAAMAV
    RHSLNYIRPGEKIRHTFSSVKMAKQKKNEQ

    >gi|189347302|ref|YP_001943831.1| heavy metal translocating P-type ATPase [Chlorobium limicola DSM 245]
    MSGTEPASGTVRCEHCLREVPLSAALKAEIDGSVKYFCCHGCLGVYELVHGASLDAFYEQRCQWLPGAPSFEKTDPHAFG
    STIVKTADGCRIDLQLSGIR
    CASCVWLIEKYLSKQDGVHSVRVNYATNRAAIHWNPEATGLDAILDMLHSLGYTARPVRS
    GGTTESLAREKQELLLRFGTAGFFSMQLMLIVAALYAGFFQGIGTEYRLAFQLISWALATPVVLYSGYPFLAGALRSIRS
    LNPNMDLLVALGSLSAYLYSIAMIPLGGEVFFDTSAMIVTFILLGRFLEAGSRLKAGNAIVALAGLQPQEAVLAKENGER
    RTVSLDQVPPGSIIEIIPGAKIPLDATVIGGEAEINESMLTGESLPVMKRSGSNIFAGTVNGNGRLLARVSGSPGETLLA
    GIIRTVEEAQSRRAPVQQLADRVAGYFVPAILLIALLTFLYRMNFGGQSSVSALMNAVSVLVIACPCALGLATPLAILVG
    STAAGKEGVLIKGGDIFETVSKTTLVAFDKTGTITRGKPSITDIVDFGTTPDLLRYAASLESASEHPAGKAIATGWIGEL
    LPVEAFRAFPGQGVSGTLQHETWLAGSTAFMLQNQVAITPEQQAQSQKIEDEGKTVVMLARGTRPAGMIGLIDEIRDDLP
    ELLSALRRRGMKIMMLTGDNPGVASRIAARCGITDLQAGLSPAGKASVIEKLKAAGETVMMVGDGINDAPALAAADTGVT
    LGSATGIALESAGVAVLTDRLLLVDTLIEHSKRCFSVIRQNLAWAFLYNLAAVPLAVSGMLHPIVAAMLMASSSLIVVGN
    SLRLQKTRT

    >gi|189347506|ref|YP_001944035.1| Rhodanese domain protein [Chlorobium limicola DSM 245]
    MKNAVEVCPTTALGMIEKGALLVDVREADEVAEASFDVPEVILIPYSEFEERFVEIPVDREVVVACNVGERSLMATYFLM
    NHGYEKVANMQYGIVRWAEKGFPMKGELKRKSGGCCCGSPSGSSNSSGSCC

    >gi|189347507|ref|YP_001944036.1| redox-active disulfide protein 2 [Chlorobium limicola DSM 245]
    MKQVKILGTGCAKCNQLADAVKAVIAREGIEASVEKVEDIQRIMAYNVLATPALVVDEEVRCKGRVPGLDELKDLLNR

    >gi|189347542|ref|YP_001944071.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chlorobium limicola DSM 245]
    MIAEGTKAPDFTLPDSDGTMISLSDYAGKRVLLAFYPGDDTPVCTTQLCSYRDNYTEFTKRDIIILGISTDSVDSHKKFG
    EKNSLPFTLLSDREKKVSRMYEATDFLGMSQRAYVFIDESGTVRLSFSELLPLFYQSTRDLLAKIDGMKPAQP

    >gi|189347956|ref|YP_001944485.1| conserved hypothetical protein [Chlorobium limicola DSM 245]
    MNILKHNVAIFTLLVAGMLPVSAGAVAPPQSVVPQVTMVADNTKGLYVVITEADPMTQMMALVLSTQTVMQGKSIQILLC
    GPGGDLALKNSRQVMMKPLNKSPQMLLADLMAKGVQVEV
    CPLYLPNKGKTEGDLIKGVTVAKPPVVAQKLRAEGIKLFTF