Chlorobium chlorochromatii CaD3 uid58375

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|78188188|ref|YP_378526.1| bacterioferritin comigratory protein, thiol peroxidase, putative [Chlorobium chlorochromatii CaD3]
    MIAEKSKAPAFSLPDSEGKMVSLADFSGKKVLLIFYPGDDTPVCTAQLCDYRNNVQEFTKRGIVVLGISSDSVASHKSFA
    ERHELPFTLLSDSEKTVAAAYDALGFLGMSQRAYVLIDESGSVLMAYSDFLPILYQPMKDLLAKIDGM

    >gi|78188377|ref|YP_378715.1| redox-active disulfide protein 2 [Chlorobium chlorochromatii CaD3]
    MKQIKILGSGCAKCNQLADVVKNVVAQEGIDASVEKVEDIQQIMAYNVMTTPALVVDEQVVCKGRIPSQSEVKEMLTAPA
    KGCCCGGGKSTGNPTGCC

    >gi|78188602|ref|YP_378940.1| thiol peroxidase [Chlorobium chlorochromatii CaD3]
    MAQINLKGNPIETVGTLPVKGTEAPFFCLVKTDLSEAGPADFASNKLVLNIFPSLDTPVCAASVRRFNQEAASYPNTVVL
    CISADLPFAHNRFCEVEGLKNVVPLSVFRSPEFGQQYGVTITTGPLKGLLSRALVVVDADGVVRYTEQVPEIVQEPDYDA
    ALKVVASL

    >gi|78188676|ref|YP_379014.1| thiolredoxin peroxidase [Chlorobium chlorochromatii CaD3]
    MSVLVGRKAPEFDVAAVVNGSQFVDSCKLSDFKGKYVVLFFYPLDFTFVCPTELHAFQEKIEEFKKRNVEVLGCSIDSKF
    SHFAWLRTPRSQGGIEGVTYTLLSDINKTVAADYDVLLEDEGVALRGLFLIDRDGVVQHQVINNLSLGRNVDEVLRLIDA
    LQFTEEFGEVCPANWNKGDKAMKPTQGGLEEFYKEG

    >gi|78188857|ref|YP_379195.1| hypothetical protein Cag_0887 [Chlorobium chlorochromatii CaD3]
    MNELIVSFGGGKKVNADFRGFTIHTDQSPLAGGEGSAPEPFTLFLASIGTCAGVYVLSFCQNRDIPTDNIRIVQSHHPKE
    SGRGIGKIEITIELPADFPEKYKEALVSAANLCAVKKHILEPPEFEVKTVVR

    >gi|78188860|ref|YP_379198.1| methylated-DNA-(protein)-cysteine S-methyltransferase [Chlorobium chlorochromatii CaD3]
    MPTTQPPPHKSRLLVQPTAIGRIAIAERNGNIVQLLFEGERVPFVYEEGESALLLEAFQQLDEYLLGKRTNFTLSLAPMG
    TPFMQAVWKALTTIPYGTTLSYGALAVQLGSPKAARAVGMANHRNPLPIFLP
    CHRVVGSNGRLVGYRGGMALKQQLLELE
    RRVVGNTALHL

    >gi|78188912|ref|YP_379250.1| thioredoxin reductase, putative [Chlorobium chlorochromatii CaD3]
    MTLNHFYCSIEEEIRDLTIIGGGPTGIFAAFQCGMNNISCRIIESMPQLGGQLAALYPEKHIYDVAGFPEVPAAGLVDTL
    WKQAERHHPEIILNETVMRYHKRDNGMFEVSVSSGHTYVSRAVLIAAGLGAFTPRKLPQLENIEALEGKSIFYAVKNVAD
    FTGKHVVIVGGGDSALDWSVGLLKSAASVTLVHRMHEFQGHGKTAHEVMEARDAGRLNVMLDTEVMGIDVENEELKAVHV
    QSKNGKTRTFPADRLLLLIGFKSNIGPLAEWGLEIVDNALVVDSHMKTSVDGLYAAGDIAYYTGKLKIIQTGLSDATMAV
    RHSLHYIKPGEKIKHTFSSVKMAKEKKKGMQNG

    >gi|78188923|ref|YP_379261.1| rhodanese-like protein [Chlorobium chlorochromatii CaD3]
    MKKRVASLALAVALTALPSPSYAIDANKLPIGKRTSSGKYLSAKEAYKMKIKDPYSVLFIDVRTPAENEFVGIADEVDKV
    IPLKLNNHAVWDHKKERYGQYLNPNFVSAIDELVLLKEKDKATPIILM
    CRSGDRSAEGANLLAKNGYTNVYSIYDGFEGD
    LETEGSKKGRREVNGWKNSKLPWGYSLKQDRAYLVVPPAAPTTLPAAPASVVAPTVQPPAAPAVPTTVAPAPQVVQPPAP
    VAAPVSKSQTTVPTPTATPAPAPVTAAAPVQ

    >gi|78188927|ref|YP_379265.1| heavy metal translocating P-type ATPase [Chlorobium chlorochromatii CaD3]
    MSTETYSVKGMHCASCAAIIEKKLSKVDGISKASVNLATETAQLSFDKESLSTEALNNILNNYGFSLERETAPEESRTNP
    TVKLQAKQAAKVEELRQQRQNVQRTLPLALLLFFWMVWESAAMSLHFIPHPPLLMHQFTLPLLVAATWVLLTVGKPFLRA
    IPSFIRNGAANMDTLIGIGTLCAYLYSATITLLPQAKSFLHASEATYFDVTIVVIGFVLLGKYLEARSKMKTGEALEALI
    TLQAKSALVERDGITVEIPIGQVRRGDTIMVRPGEKIPVDGIITDGTSAVDEAMVTGESLPVDKKAGDGVIGGTMNKQGS
    LTFIAAKVGSDTMLARIIRMVEDAQSSKAPIQQLADKAAAIFVPTVLILAALTCILWLTLGTLWLGFSTALSYAIMGTVG
    ILVVACPCALGLATPTAIIVGIGKGAAEGILIRNAESLEKLSRVNTVVFDKTGTITSGKPSLHAVVPFDGKSTSNTLLTL
    AAMLESRSEHPLAQAIVEAARLQQIAFGEVTNFSAQEGVGVTGMVDGRAITIRKPQQNEEHGREAIEALQAEGKSIVVME
    ENGVALGVLALSDTIKPEAASAVATLKHKGIRVLMLSGDHQAAANAVAAQAGIDEVIADVLPHDKANKVMELQAKGAIVA
    MVGDGINDAPALAQADVGIAMATGTDVAMETAGITLLKGDINKIPQALNLAHATMRVIRQNLFWAFFYNIICIPLAAGAF
    YPIWGILLNPAFAGLAMAGSSVSVVSNSLRLKRIQVKEKQN

    >gi|78188928|ref|YP_379266.1| bifunctional methionine sulfoxide reductase B/A protein [Chlorobium chlorochromatii CaD3]
    MQYNHLTPDEERVMLHKGTELPFSGIYYDHHDSGTYHCRRCNTALFHSDNKFNSGTGWPSFDDAIEGAVRQIPDADGRRT
    EIVCANCGAHLGHVFFREGFTTKNVRH
    CVNSISLNFQPQATQATIPTTTQTAVFAGGCFWGVEYHFSKLKGVLSVTSGYT
    GGAIENPTYQQVCSGKTGHAEAVEIVFDAAQVSYETLAKLFFEIHDPTQVNRQGPDVGTQYRSALFYANEEQRRIAEKLI
    GELQAKGYRVATSVEPASQFWAAEAYHQEYYARHGHEPYCHVYTKRF

    >gi|78188996|ref|YP_379334.1| heterodisulfide reductase, subunit A [Chlorobium chlorochromatii CaD3]
    MAKIGVFVCHCGENIAGKIDCNKLNDAIKEHPGVEIAFDYKYFCSDPGQESVKKAIRDNHLTGIVVAACSPRMHEATFRK
    ACAEAGLNPYLCEIANIREQCSWVHSDGDMATQKAIDITRSMVEKVKLNNTLQPIEVPVTRKALVIGGGIAGIQAALDIA
    NAGQEVVLVEREASLGGHMAQLSETFPTLDCSQ
    CIMTPRMVETAQHPKIKLLTYAEVDSVEGYIGNFKVKVRMKARYVIK
    DQCTGCGDCILKCPQKKIPSEFDCGLGNRPAIYTPFAQAVPNIPVIDRDRCTYFKNGKCQLCVKACQLNAIDFQQQDEFL
    DIEVGAIVVATGFQIQNNAVYGEYGYGKYKDVINGLQFERLASASGPTSGKILRPSDGTEPETVVFIQCAGSRDPSKGVK
    YCSKICCMYTAKHAMLYAHKVHHGKTHIFYMDIRAAGKGYDEFTRRAIEEDEASYLRGRVSKVWEENGKLMVRGVDTLLG
    KPVEIAADMVVLATAIVPQPDAKEFAKTIGIGYDEYGFYNELHLKLRPVESSTAGIFLAGACQSPKDIPDSVAQASASAS
    KVLALFSREKLEREPVVASNNESTCAGCWGCVLACPYNAIEKKDICDRQGNVIKRVASVNPGLCQGCGTCVTFCRSHSLD
    LAGFTEKQIFAEVMGL

    >gi|78189116|ref|YP_379454.1| hypothetical protein Cag_1149 [Chlorobium chlorochromatii CaD3]
    MLRKKLPLLLCAAALLSPMNSLYAGKPTAQAKSSVADGAAAASSNQASMSAIVPVADHTKGIYLVLTEADAMTQMMALVL
    ATQHLEQGKTVQVLLCGPAAKLAVKNCKEEPTIFKPINKSPQMLLAVLLSRGVQVEV
    CPLFLPNSNMTQEQLIAGVTVAK
    PPVVASQMRADGIKTMNF

    >gi|78189117|ref|YP_379455.1| thioredoxin [Chlorobium chlorochromatii CaD3]
    MSGKYFVATDSNFKAEILDSNKVALVDFWAAWCGPCMMLGPVIEELAGEYEGKAIIAKLNVDENPNTAAQYGIRSIPSLL
    IFKNGQIVDQMLGALPKNMIAKALDKHLA

    >gi|78189118|ref|YP_379456.1| thioredoxin reductase [Chlorobium chlorochromatii CaD3]
    MERTVRDLIIMGTGPAGYTAAIYTGRANIRPLVIEGIQPGGQLMITSEIENFPGFPEGIRGPELMGRMREQAAKFGAEFV
    AGSVTEVDLSKRPFSVTLEDGQEFLTHALIVATGANARWLGIESEDRYRGKGVSA
    CATCDGFFFRNCHVMVVGGGDTAME
    EALYLTKFASKVTLVHRRGEFRSSKIMSLRVTKHPKIEMLLNQVVEEVLGDGFKVTGVRLKNVATGEVSDHSCDGLFLAI
    GHAPNTVLFQDQLELDDYGYIQTKKSSTETNVPGVFACGDVQDYTYRQAVTAVGTGCMAAVDAERYLETIR

    >gi|78189183|ref|YP_379521.1| hypothetical protein Cag_1216 [Chlorobium chlorochromatii CaD3]
    MQQKLLLISTIGPEHPEKATLPFVIATAAQALDVKVVMFLQSNGVILAKKGEAETIAAPGLVPMKELLDTFLEMGGTLML
    CSPCLKERYITPNDLIEGAEIGAAGTLVSEIMSATSVVTY

    >gi|78189237|ref|YP_379575.1| rhodanese-like protein [Chlorobium chlorochromatii CaD3]
    MIDCQFELFNVRMKNIKEVNAVNAHAMLKKGALLLDVRESFEVSRGTFDVPDVKHIPMRELEQRLHEIPAKRQIIIACRS
    GSRSMMAARMLMSRGYHKVANLQHGVMGWQRAGLPMSKAQKQHVESFLVRFLKLFKRS

    >gi|78189242|ref|YP_379580.1| dihydrolipoamide dehydrogenase [Chlorobium chlorochromatii CaD3]
    MTLSFDIMVIGGGPGGYIASIRAAQLGMSVACCEYNPYDDPAGEPRLGGTCLNAGCIPLKALVASSEAYEHATTHFAAHG
    ISVSGLSMDVTKMQKRKESIVRRMTAGIQFLFKKNNVTLLKGCGSFVGKSEDGYRLLVKGKEGETEVTARNVIIATGSTP
    RHLPNITVDNLTI
    CDNVGALKLSDVPKRLAIIGAGVIGLEVGSVWRRLGAEVTLLEMLPTLLPFADESIATEAAKLFKKQ
    GLNIVTGVSISEIKHEATGVSIAYSDKDGAPQSVECDKLMLSIGRTPNTNGLNLEAIGLQPDARGFIPVNEQCATTIHGI
    YAIGDVVRGPMLAHKAEDEGVMVAEVIAGQNAHINYNAIPSVIYTSPEMAWVGQSEQQLRAEGRAYKAGQFPYGANGRAQ
    GLGAPEGFIKMIADADSDKILAVHCIGASASELIGEATLAMEMGITAAELARTCHAHPTLSEVMREAALAVHGRALNV

    >gi|78189332|ref|YP_379670.1| heavy metal translocating P-type ATPase [Chlorobium chlorochromatii CaD3]
    MSEIKRTNNDRLRCDHCQQTVSRTSAIIATINGDEKVFCCHGCLGVYELLHNNALDTFYNERCTLQPTSVTEGKAPEAAA
    FRDTVISNGNEQQIDVLLSGIR
    CASCVWLVETVLLKQQGILSARVNYATHKATITWQQGAITLDTILQTLHKLGYQPHPY
    RGSSNDVMIAEKQDLLLRFGTASFFSMQLMLFTAALYAGFFDGMESRYKLAFQLIALALATPVIFYSGYPFLANALRAIK
    RLTLNMDVLIALGSLASYLYSIAMIFADGEVFFDTSAMIITSILLGRFLEAGSRLKANNAIAELAELQPHEALRVSNNGE
    TNRVAVATIQSGEVIEILAGNRIPLDGKVVEGEAEVNEAMLSGESTPVLKGMDSEVFAGSTAMNGRLRVRVSGNASTTLL
    AQIIRTVEEAQARKAPIQSLADKTAAYFVPAIIALATVTFLYWKFTNGNTVIALMNAVSVLVIACPCALGLATPLALLVA
    TTATSRHGLLVKGGDVMENLSTITTVVLDKTGTITTGKPSLTDCFLMDENLPFIQHAASLEALSEHPTARAITAAWQGER
    LEVTHFKAITGKGVSGIIEQTHWYAGSKAFMEQEKISIAPKEQERIAALEAEGKTVVIVARDRSIVGIIGMIDELRSDAL
    PLINGLRTKGLKLHLFTGDNKGVARYIAERCGISDVQAEQSPLDKAARIRALQAHGERVMMVGDGINDAPALTEATVGVT
    LGNASAIALDSAGVAILHDDLRLITTLLNDASRCFSIIRQNLVWAFSYNLIALPLAVSGTLHPIVSALLMATSSLVVVSN
    SLRLRKSSRKTAPL

    >gi|78189427|ref|YP_379765.1| hypothetical protein Cag_1466 [Chlorobium chlorochromatii CaD3]
    MATHHVLLYGKEGCCLCEKAFDALQRLQQSVAFTLETKDITDDPELFRSFRYRIPIIMVDGEQACAVRVDEAKMRTLLA

    >gi|78189515|ref|YP_379853.1| nitrogenase-associated protein [Chlorobium chlorochromatii CaD3]
    MATIIFYEKPSCRNNTRQKALLAEAGHVVEARNLLEQEWTTEELEKFFGSKPIADCFNTSAPAITSGQLQPESLSRNEAL
    ALMVKEPILIKRPLMTIGEHYLQGFSMDRLHELIGLTAESEKTDFSQCPHDATSVCR

    >gi|78189544|ref|YP_379882.1| heterodisulfide reductase, subunit A [Chlorobium chlorochromatii CaD3]
    MSVETIVIVGGGISGITTAVEAAEVGYNVILVEKNAYLGGRVAQLNKYFPKLCPPYCGLEMNFRRIKLNPKITVYTLTEV
    ENVSGKEGDYSIKLKVNPRYVNEKCTACNACAEVCPAERSNDFNFGMNKSKAIYLPHELAYPTKYVIDRKACAQSCDKCV
    KACVYNAIDLTMKPETVEVKAGSIVYATGWNPYDATKMQNLGFGRVKNVITNMMMERLAAPNGPTGGKIVRPSDGREVKK
    VVFVQCAGSRDQNHLNYCSAICCMASLKQATYIRDRYPDADIMIAYIDLRTPGKYEAFLNKVENDKRIRLVKGKVAQIEE
    DRATGNVILTSEDVEGGGKSTYEADMVVLATGMAPSVSDHPMLAFEQNGFIQGGKAAGIYSTGVAKRPSDVTTSLQDATG
    VALKSIQSLVRS

    >gi|78189551|ref|YP_379889.1| hypothetical protein Cag_1591 [Chlorobium chlorochromatii CaD3]
    MQNKAIPHSPAEQVALLDSNECSLPRFHERLASEGVSQLQADGIEILQLNIGYRCNLRCTHCHVNGSPERHELMSREVME
    QCLVALDKSNATTVDITGGAPEMNPHFRWFIGELRATKPDARILVRTNLTLLTDNKTYSDIPELLKAHRIALIASLPCTT
    KKTVDAVRGDGVFDRSIAALKLLNSIGYGTSDSALELNLVFNPSGAFLPEAQQQLEHHYRTELQNKYGITFSHLFTITNM
    PVSRFLENLCTNGTYCDYMKLLVDSFNPTSVKNVMCRTTLSVGWDGTLYDCDFNQMLRLPVECSVPQHINAFDAEVLSKR
    HIVTNQHCYGCTAGAGSS
    CQGCLV

    >gi|78189562|ref|YP_379900.1| bacterioferritin comigratory protein, thiol peroxidase, putative [Chlorobium chlorochromatii CaD3]
    MATSLLSVGTAAPEFSALDQNGQSVSLTEYRGRKVILYFYPKDDTPGCTKEACAFRDNFPTFNAIGVEVLGVSIDDGAKH
    KKFVEKYQLPFRLVADPDKTIVQAYGVWGLKKFMGKEYMGTNRVTYLINEEGVIEKVWPKVSPEKHAQELIAYLQPSA

    >gi|78189640|ref|YP_379978.1| thiol:disulfide interchange protein DsbD [Chlorobium chlorochromatii CaD3]
    MKQTMIGRVVALFFMLIVALVQTLPLSAAELLGPDEAFRLQAELQDKRALRLQWTIANHYKLYREYVRVSVTEGKAELQP
    LTLPKGIMTTDPVSGEKIEIYHDQLTVSLPMLNADAPFTLNVSYQGCAEDGLCFPPITKRFRVNPEQVGKLTPLADASLD
    GGANPFAAMQQEATSESATSAKASTPQPKNQPENDFSLATSALASGSLWQIVPLFFLFGLLLSFTPCILPMVPIISSIIV
    GEGNSSRSRSFLLAVAYCLGMALVYTSLGVAAGLAGEGFAGFLQKPWVLILFSLLLFVFALSMFDLYQLQIPTALQNRLC
    KASGNLKRGRFVGVFFMGALSALLVGPCVAGPLAGTLLYISQSRDVLLGGFALFAMATGMSVPLLLVGVSAGSLLPKAGT
    WMVGVKYLFGVLLIGVAIWMVTPVLPMALQMVLWAALMLLSALFLGLLDAAPEKATVGMRFKKTAALLLLCGALVEVVGA
    ASGGSNPLQPLAHLRPSAGSSDAPANNQLHFTTVRSLAELETILQSTNKPVMLDFYADW
    CVSCKEMDAFVFEKPEVQQAL
    SSMQLLRVDVTANNADDRALLKRFNLFGPPGIIFFNAEGKEIAGSHIVGALDAEAFLQHLQTLP

    >gi|78189881|ref|YP_380219.1| thioredoxin family thiol:disulfide interchange protein [Chlorobium chlorochromatii CaD3]
    MKHSTLFIAALAIVTGGTIAQNNTLNAAPPTAKQSVKGATAPTFTAKSVQGHIVSSQQLAGKPYIVNFFGSWCPYCRKEI
    PDMIALQERYKAQGFTFIGAAYQDNENAMPDFIWEHNINYPVIMADSKIINSFAPYIAGGIRSVPLLFAIGRDGKIVAVE
    PGAQTREDLEKLIQKLLQRPAKR

    >gi|78189898|ref|YP_380236.1| polysulfide reductase, subunit B, putative [Chlorobium chlorochromatii CaD3]
    MNEQRREFIRLAGMGFLASVGATCGLMSSAPLEATDLTVFADSGNGAVRWGMLVDTRKCREGCNKCIESCHTVHNVPDFA
    SAKERVQWIEKRPVASLFSERKALPAQSATLPALCNH
    CAKAPCVTACPTSAIFRRYDGIVGLDFHRCIGCRACMTACPYS
    AISFNWKAPRPAIKSLSDGYPTREQGMVEKCNFCSERLAKGLMPACAESCPEHALVFGNLNDPASEIRTLLASSRTLQRK
    AEQGTKPSVFYII

    >gi|78189905|ref|YP_380243.1| DsrE protein [Chlorobium chlorochromatii CaD3]
    MKIGILLKEGPYNHQASDTAFKFAEAAIKKGHTIDAVFLYNDGVTNVTKLMDPPQDDRHIAGRWSELSKQHGVEILACIA
    ASKRRGINDDVLVEGSSITGLGTLTDIAIRNDRLVTFGD

    >gi|78189913|ref|YP_380251.1| rhodanese-like protein [Chlorobium chlorochromatii CaD3]
    MIRYTDFVAQCLPHIKEVLPWVLVERMAANPELLILDVREPYEFERLHIKNSINVPRGVLETACEWDYEETVPELVQARE
    REIVIV
    CRSGHRSVLAAYVMQLMGYTNVFSLRSGLRGWNDYEEPLSTSAGAIVDPQYADDYFVSKLRPEQFAPKR

    >gi|78189933|ref|YP_380271.1| peroxiredoxin [Chlorobium chlorochromatii CaD3]
    MHDDELYYDISMPLLGDDFPEMEVQTTHGVMNIPGDLKGSWFVLFSHPADFTPVCTTEFVAFQERIAEFDKLGCKLIGMS
    VDQVFSHIKWIEWIKDTLNIEITFPIVAANDRIANKLGMLHPGKGSNTVRAVFVCDPNGKVRLVLYYPQEIGRNMAEILR
    AVTALQISDNNKVAIPADWPNNSLIKDEVIIPPAKDVAEAQKRKNMGGCYDWWFCHKPLDK

    >gi|78189966|ref|YP_380304.1| thiol:disulfide interchange protein, thioredoxin family protein [Chlorobium chlorochromatii CaD3]
    MKLLRSLTATIVCSLLFLSVPAVMQAAPKAPAFSAVSVTGKATDTKQLAGKTYIVNFFASWCPPCRAEIPDMVALQNKYS
    KKGFTFVGIAVNEDAENIRSFITKNNINYPVVMATPELVDSYNRYVQGGLRGIPTSFVVNSSGEITQVISGGRSYAEFEK
    IILGAMKKSTVAAPKK