Chlorobaculum parvum NCIB 8327 uid59185

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|193211686|ref|YP_001997639.1| Flavocytochrome c sulphide dehydrogenase flavin-binding [Chlorobaculum parvum NCIB 8327]
    MSISRRDFNKLLLSGAAGSMFGLLGASGKAFAGTKRVVVVGGGFGGASTAKYLRKLDPSISVTLVEPKAAFVTCPFSNWV
    LGGLRTMADITHNFNALQNTYGVTVIADKVVSINPGKHEIMLGSGKRLGYDRLVVSPGIDFKWEAIPGYSQQIAESSMPH
    AWQAGAQTVLLHKQLQAMKNGGTVLLCPPGNPFRCPPGPYERASLIAHYLKQHKPKSKVVILDAKDKFSKQGLFTKGWER
    LYPGMIEWHAASSGGKVLGVDAKAMTVETDFGPVKGDVINVIPPQKAGKLAFDAGLTNESGWCPVDPSSFESTIHPGIHV
    IGDSCIAGAMPKSGFAASSQGKVAAAAIINLLNGHKPVPPSLVNTCYSLIGTNYGVSVAAVYELSDKGIVSIPGSGGLTP
    ADASDDQLAQEAMFAEGWYTNISKDIWG

    >gi|193211700|ref|YP_001997653.1| Rhodanese domain protein [Chlorobaculum parvum NCIB 8327]
    MSRLNDLLEKTLSEIREIMPWNLVDRMAENPELIILDVREPKEFETLHIEGSIHVPRGVLESACEWDYDDTVPALVTGRD
    KEIVVV
    CRSGRRSAFAAKTMQELGFTNVVSLKTGLRGWNDYEEPLVNSAGETVGEEFADDFFTSKVRPDQLKPKP

    >gi|193211721|ref|YP_001997674.1| Redoxin domain protein [Chlorobaculum parvum NCIB 8327]
    MIVMKKFTPSFAAICLALVLFAVQATVSGTARAASVAAPSFSGKTVDGKPFSSSSLKGKGYIVNFFATWCPPCRAEIPDM
    VEVQKKYEKKGFTFVGIAVNETLPKVQNFMKSSGITYPVLMATPELIRTFSGYAAGGISGIPTSFVVDSSGQLIGVVVGG
    RSQEAFEQMVNQALKPKAGK

    >gi|193211728|ref|YP_001997681.1| methionine-R-sulfoxide reductase [Chlorobaculum parvum NCIB 8327]
    MSSNHSQNPYYSRTDTTKLDLPDEVWKKVLSPELYAVARKGETERAFTGKYWNYEGLGTYYCAACGNALFRSDAKFASTC
    GWPSFFETVRPGSVEYREDNSYGMMRTEVLCGRCDAHLGHVFDDGPPPTGKRF
    CMNSVSLDFEPDSN

    >gi|193211911|ref|YP_001997864.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chlorobaculum parvum NCIB 8327]
    MIEKGKQAPEFSLPDAQGKMVSLSEFKGKKVLLIFYPGDDTPVCTAQLCDYRNNVTQFTQRGIEVIGISGDSPESHRQFA
    EKHELPFLLLSDEAHSAAKAYDALGFLGMSQRAYVLIDEQGTVLLAYSDFLPITYQPMKDLLARIDES

    >gi|193211995|ref|YP_001997948.1| alkylhydroperoxidase like protein, AhpD family [Chlorobaculum parvum NCIB 8327]
    MSIRWLPAPDIERASGLAAEVYRQLDEEFMTVPPVTLHHLNSQLMAGVWSACRESLVAGPDRALKELIAVAVSQSNRCPY
    CVQAHSSMLQDANDRPALDAVSSGERANDDLSNLAAWASATGRKAALASVPPPFTKPQAPAFMATAVLFHYINRMVNIFL
    DDTMMPVVGKVPVIGDQAFRLFSSVTSGRIVRIDAKPGVFLTGSPAMKLPEEFGWAGDDPAVAGGLLRFADAVRAIADSV
    DSGVQSLVKRHVVAWQGEPPGIDKGWLEDAVRTLPEKLKPQARLALLAAMASWAVDSGEIASCRRAGLDDRALLETSAWG
    AYLATERIASWLSR

    >gi|193212034|ref|YP_001997987.1| Rhodanese domain protein [Chlorobaculum parvum NCIB 8327]
    MKKIVSLVVTLLLVSTSLLHAASFDASQLPEKKRTISGKYLSAKGAYEMVTKAPAKVLFVDIRTPEENEYVGIADQVNLN
    IPYMLNDFSTWDSKKNRYQMSPNSAFTMKIADALAARGLKKTDPIILI
    CRSGDRSAAAADLLTKAGYTNVYSVYEGFEGD
    KSKEGFRTVNGWKNAGLPWGYKLDQARAYLVF

    >gi|193212117|ref|YP_001998070.1| redox-active disulfide protein 2 [Chlorobaculum parvum NCIB 8327]
    MKQVKILGTGCAKCNQLADAVKAVIASEGIDADVQKVEDIQEIVSYGVMSTPGLVVDGVVVCSGKVPSSDELRVMLAAAP
    KSSGCCGGHGGSCCS

    >gi|193212317|ref|YP_001998270.1| amine oxidase [Chlorobaculum parvum NCIB 8327]
    MSETLDVIVIGAGIGGLTSAALLQERGFKTIVFEKNAFPGGSCSAFRKGGYTFDAGASVFYGFNEDDSVGTLNLHARIFR
    KLGVSLETVPDPVQIHYHMPAGFEVPAWYDRRRFLDVLIRRFPHEKEGIVKFYDALESVYDILSSLPAGSLEDVMHLAGV
    GAKHPLKTMALGVKTLYSMGGTARRFISDPELLRFIDLESYSWAVQDASSTPLVNAGICLADRHHGGINYPIGGSGAIPD
    ALVKGYEKYGGSVRYRSEVKSVIVENGAAVGVRLADGSEVRARAVVSNATVWDTFNRLVDDSRLRVPEDRFIKAPSWFQI
    WLGVDGSIVPNDFHMHHIIVDDWAKYDKLGGTIYFSAPSVLDPSLAPEGKHALHLFVTAETSQWEQYERQSPEYRNAKEE
    FARSVIARAESILPGLQKGVELMVTATPQTHVRYLNRRDGSYGPLLKPGQNVLLKPQNRTPVKNLFSAGDSTFPGQGVIA
    VTYSGVSCASYIARQFGKPLDYL

    >gi|193212328|ref|YP_001998281.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chlorobaculum parvum NCIB 8327]
    MELLQAGQKAPEFKTIDQDGNPVSLKDYRGRKVILYFYPKDNTPGCTKEACAFRDNLPNFKKIDAEVLGVSVDGQKAHRK
    FADKFELPFTLVVDEDKKIVEAYGVWGLKKFMGKEYMGTNRVTYLIDEQGVIEKVWPKVKPEIHAAEVLEWLQQKA

    >gi|193212390|ref|YP_001998343.1| dihydrolipoamide dehydrogenase [Chlorobaculum parvum NCIB 8327]
    MQQSESSSAQFDVAVIGSGPGGYEAALHAARHGMKVCLVEKASLGGVCVNWGCIPTKALLRSAEVYDLAKNPSEFGVNVS
    ELSFDLAQAVKRSRKVSLKSSKGVEFMLKKAKVEVWRGEAVLTGSKGVKVTAEDGSERSLEAANIIVATGAQPRVIPGLE
    PDGKKIITSREALILKDVPESMIVVGGGAIGVEMAWFYAKAGAKVTIVELMPRLLPAEEAEVSEALKRSFEKVDITVQCG
    AKLGNVAISEFGVNADLLAEGKEPQKIEASCMLVAVGVTGVIDGLGLDAAGIETERGFIRTDELCRTSASGIYAIGDVRG
    GMLLAHKASAEAAIAVEAIAGKLPEPLSEPLIPRCVYAQPSVASVGLTEEAAIAAGYKVLVGRSQFAASGKANAYGQLEG
    FVKLVFNAETGKMLGGHLIGHDAVELIGELGLACRYGVTAEGLVGTVHAHPTLSETVREAAFAALQSKG

    >gi|193212507|ref|YP_001998460.1| heavy metal translocating P-type ATPase [Chlorobaculum parvum NCIB 8327]
    MTKRTYSVKGMHCASCVAIITKKLSALDGIAKADVNLATETARIEFTGKPLGIKVMNELLGKYGFSLVEETPPKSAAQEI
    PTDRHASKKQEKLDELLHQKRQVQVALPLALLFFAVMMWHTVAALVPSIPQFPIDMETWHSITLLVAAWVVFRIGEPFLK
    GVGTFARTGTASMDTLVGMGALVAWSYSAFSILFPTLRDRLGLPHESFADAAIVVIGFVLFGKYLEARSKLKTGEAIEKL
    VGLQAKSAIVYDNGKETEVPVETVVEGTMLVVKPGGRVPVDGVIFSGSSSIDESMITGEPVPVDKHEGDTVIGGTINKQG
    AFTFTATGVGTETMLARIISMVEDAQGSKAPVQNLADKVAAVFVPTVLVVSVLVFLLWLGIGTPALGFKSALSYGIMAIV
    GILVIACPCALGLATPTAIIVGTGLGAKHGILVRNAENLQTLSKIDTVVFDKTGTITRGEPSVTSIEPFDKNDKTDELLA
    LAAGIEKHSEHPLAQAIVTAAKERNIEPLKVSDFKALEGVGVDAKLGDDPVRVRKPEGNESARPEIERLQQEGKTVVIIE
    QNGKTLGLIALSDTLKPEAKETVAELQRMGKRVVMLTGDNRHAAEFIARQAGIDEVVAEVLPGDKADAIKKLQAEGRTVA
    MTGDGINDAPALTQADVGIALASGTDIAIESAGITLLGGDIGKVTQAITLSKKTMRVIRQNLFWAFIYNVIGIPIAAGAL
    FPFYGIFLNPAFSGIAMAGSSVSVVTNSLRLRAAKLS

    >gi|193212528|ref|YP_001998481.1| thioredoxin [Chlorobaculum parvum NCIB 8327]
    MSGKYFVATDQNFQSDIINSDKVALVDFWASWCGPCMMLGPVIEELAGDYEGKAVIAKLNVDENPNTAAQFGIRSIPTML
    IFKGGQVVDQMVGALPKNMIAKKIDEYLA

    >gi|193212529|ref|YP_001998482.1| thioredoxin reductase [Chlorobaculum parvum NCIB 8327]
    MDKDIRDVVIIGTGPAGYTAAIYTGRANLKPLVIEGHQPGGQLMITTDIENFPGFPEGIPGPELMGRMREQAARFGVEFK
    FGSVTEADVSRSPFSLTLDDGSEILARTIIIATGANAKWLGIESEETYRGRGVSA
    CATCDGFFFRNCRVFVVGGGDTAME
    EALYLTKFASEVVLVHRREEFRASKIMSLRASKNEKITTMLNEVVDEILGDGMKVTGIRLKNVKTGELTEHACDGVFVAI
    GHEPNAKLFQGQLDMDDYGYILTKPHSTETSVKGVFACGDVQDFTYRQAVTAVGTGCMSAIEAERFLESIR

    >gi|193212605|ref|YP_001998558.1| 4Fe-4S ferredoxin iron-sulfur binding domain protein [Chlorobaculum parvum NCIB 8327]
    MAKIGVFVCHCGENIASVVDTEKLVKEISEHPGVAVATEYKYFCSDPGQETVKRAIRENNLTGVVVSACSPRMHETTFRK
    ACAEAGLNPYMLEMANIREHCSWVHSDKEEATNKAIEITRSLVEKVKRNNDLKPISVPVTRRALVIGGGIAGIQAALDIA
    SAGREVVLVEREPSIGGHMSQLSETFPTLDCSQ
    CILTPRMVEAIQHPNIKVLTYSEIESVDGYIGNFKVKVRKKARYVDM
    DKCTGCGDCIQKCPVKKIPSEFECGLGNRTAIYTPFAQAVPNVPVIDTTRCTYFKNGKCKICQKTCQIENCIDFEMQDTF
    EEIEVGAIVVATGFQIQDTTLYGEYGYGKYKDVITGLSFERLASASGPTGGVIRRPSDGKIPDTIVFIQCAGSRDPSKGV
    KYCSKICCMYTAKHAMLYAHKNHDGKSQIFYMDIRAAGKGYDEFTRRAIEEDGAEYLRGRVSKLYEENGKLIVRGVDSLL
    GKPVEVAADMVVLATAMVPQPDAKETAKKIGIGYDEYGFYNEAHLKLRPVETATAGIYLCGACQSPKDIPDSVAQASAAA
    AKVIGLFSREQLEREPVVASVSDATCAGCFGCVMACPYNAIDVRDINDRNGNLIKQVADINPGLCQGCGTCVTFCRSNSI
    DLAGFTEKQIFAEVMAL

    >gi|193212691|ref|YP_001998644.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chlorobaculum parvum NCIB 8327]
    MSFILKRVSSVLIAFIVAFGISVDAKAFEPGEQAADFTLPGKTGVVKLSDMKGSVIYLDFWASWCGPCRQSFPWMNRMQA
    KFKDKGFQVLAVNLDAKTDQATKFLSQVPADFTVAFDSKGQTPRVYGVKGMPTSFLIDRNGKVLWQHAGFNSADTQELEQ
    KIQAALEAR

    >gi|193212695|ref|YP_001998648.1| Protein-disulfide reductase [Chlorobaculum parvum NCIB 8327]
    MIKQVTPRRLISVFTVLLILLMRSTTGLAADFLDPEQAFKISAELTGNKTIALHWNIAESYKLYKNQMTVDVTSGTATLG
    NPSFPEGILFTDPTTGEKEIIYHDKLTVEVPIKEALAPFTVSVGYQGCSEDGLCYPPITTDFRVDPSKPGVLSIVTEPDG
    SGSAGLLPATAQVQPETVTPASTASKESGGQNDLSLAKSTLESGSWWKISAAFLLFGLLLSFTPCVLPMVPILSSIIVGE
    GESTKMKSFLMAVAYCLGMALVYTSLGVAAGLAGEGLAGALQKPWVLALFSLLLVALSLSMFDVYELQLPSSLQTSLNKT
    TGKLKGGKFAGVFLMGAISALIVGPCVAAPLAGTLVYISQTKDVFIGGLALFSMAMGMSVPLLLIGLSAGSLLPKAGAWM
    IGVKYVFGLLLLAVAIWMVTPVLPPQALMVAWGTLGILCAVFAGVFGPPAEKLTIGGKFKKALGLVLFIIGVMELVGAAS
    GGTDALKPLSGFHSVSGSVATKTEHLTFKRVHSIDELDRELQASAGNPVMLDFYADW
    CVSCKELEKFTFSDPKVQQALAN
    VTLLQVDVTANSEDDKALMKRFSLFGPPGIIFFDKSGNEQSDNRIIGFVEAQEFLRHLERL

    >gi|193212716|ref|YP_001998669.1| conserved hypothetical protein [Chlorobaculum parvum NCIB 8327]
    MSMFRKSMTALALTLALLFSFGTSVNTASAEPQATVQSSNKGLFVIVTSDDSMAQMMAMVLSTQTLNQGRSVRVLLCGEA
    GELALKGSQEKMFKPLNKSPQMLLKGLIAKGVKVEV
    CPLYLPNTGKQPSDLIAGVTVAKPPVIAAAMAEEGIKLLTY

    >gi|193212730|ref|YP_001998683.1| Redoxin domain protein [Chlorobaculum parvum NCIB 8327]
    MNSVRKLFGAAFLAFCISGMAAPVPAVAAVFQDSFPAIAEHAPAFRMKTLDGREVTSAQLAGKPYIVNFFASWCPPCRRE
    LPGMVELQKKYAKQGFTFIGIAFRDRASTLPDFLWEMGVEYPVGMTNPELEATFGQYLTDGRIRAIPVSFVVGRDGRLLN
    AVTGGLTKEDFESLILKAISTKPAK

    >gi|193212808|ref|YP_001998761.1| thioredoxin [Chlorobaculum parvum NCIB 8327]
    MQSRAPFDFQNDVIEQSNFIPVLVDFWAPWCGPCQSLAPVLESLAERHVDKWKLVKVNTEELPDIASRYGVRGIPNVKLF
    SHGEVIDEFTGALPEYQIEQWLKKALPSQWAEQVQRASAEMADGNEAGAVTLLEEVLANEPDNSKAAAMLIRLILFSRPD
    EALRLAEPLEGEPEYADLSEAARTLGTLLVRPPGELPDGDSKDAYGSAIESLRAGELDSALDRFIGVLREDRYYDDDGSR
    KACIAIFRLLGEEHDITMKYRRTFDRAF

    >gi|193212823|ref|YP_001998776.1| OsmC family protein [Chlorobaculum parvum NCIB 8327]
    MASDLIVTFGGGKKVNAEFRGFTIKTDQSVHGGGEGSAPEPFALFLASIGTCAGIYVYSFCQSREIPTDGIKIVQSHEPK
    AGGRGIGKITLTIEVPPTFPEKYKDAVINAANLCAVKKHIMEPPAFEVKTEVVEG

    >gi|193212930|ref|YP_001998883.1| peptide methionine sulfoxide reductase [Chlorobaculum parvum NCIB 8327]
    MTWNKLTPEEKYVIIDKGTERPFSGEYYLNKEKGVYQCRQCGADLFRSDAKFESGTGWPSFDDAIPGAVRQETDRDGRRT
    EILCANCGGHLGHVFFNEGFTSKNARY
    CVNSISLSFDPADKPAPTTEKAIFAGGCFWGVEYHFKKTPGVISTTVGYSGGH
    TDHPTYEEVCTGRTGHAESIEVEFDPSVVSYETLAKLFFEIHDPTQENRQGPDIGTQYRSAVFYQNEQQKKIAEALIDQL
    KSRGYDVVTTVEKAGEFWPAELYHQDYYEKTGHRPYCHIYQKRF

    >gi|193212931|ref|YP_001998884.1| protein of unknown function DUF255 [Chlorobaculum parvum NCIB 8327]
    MEQQPNRLINEKSPYLLQHAWNPVDWHPWGEEAFRKAQQQELPIFLSSGYSTCHWCHVMERESFEDPEIAGFLNAHFVPV
    KLDREEHPDIDRFYMLFVQATTSNAGWPMSVWMTPDRKPFFGGSYFPPAERWGMPSFRSVLETLARMWEHDRPKLLASAG
    SIMDQLFDIAKPQSGPGDVSDAHAARCFEALAQRFDAEWGGFGNAPKFPQPSILGFLFSHAARTGNQTAADMALVTLRKM
    AAGGLHDQLGVTGRGGGGFARYSTDRFWHVPHFEKMLYDNAQLAASYLEAYQLTGEALFADTARDIFNYVLCDMTSPEGG
    FWSAEDADSLDPNGSGEKREGTFYVWTEEEIGNLLDPDEAVLFMEAYGVRPEGNAPVDPHGEFIGRNILKRTASDEELTN
    RFGLSMDEASRRLKEARSKLFESRLTRPRPGLDDKILVAWNGMMISALAKGALVLRDKKLLEAAERAALFILGTLYDSAT
    GKLLRRYRDGEAAIDGKASDYACMIQALIDLYQASLDPEYLSTAIALAETQIERFFDQKQGVFYSTAFDDESAPLRMIED
    NDTAEPSPNSVSAFNYLRLAAMTGRDELREIALRTINFFSSTLDANPVALPLMLAARAMADTAPAQLIVSGKRSDPAIQR
    FVEAASRHFQPELTILHANENVEWLPSEAVAIAKDHHGQPAAWLCAKGQCYPAVTEPEELDTLLKSLG

    >gi|193212938|ref|YP_001998891.1| methylated-DNA/protein-cysteine methyltransferase [Chlorobaculum parvum NCIB 8327]
    MQQESILTNYSSFSCRRMPVGLIGIRAHGGRVTDLLFMHVEPSTAVSAPGSPLIDEAFGQLDAWFAGRLKAFSLPLADAR
    TDFERRVREAMLAIPYGQTAPYGELAAAIGSPGAARAVGSACGRNPLPIIVP
    CHRVVGVGGRLGGYSSGVELKRWLLDFE
    RRNRG

    >gi|193212941|ref|YP_001998894.1| thioredoxin [Chlorobaculum parvum NCIB 8327]
    MAKSLDDLIRTSALPVFVDFWADWCGPCKIVAPAVQQLAKEFKGRITVVKVNVDQQPDAAARFQVQGIPALMLFVGGQIQ
    WRTAGAIPYQQMRQEVLKVIG

    >gi|193212968|ref|YP_001998921.1| Redoxin domain protein [Chlorobaculum parvum NCIB 8327]
    MATITLKGNSINTAGELPAVGSQLPAFTLVKSDLSEVTQADFAGKKVVLNIFPSLDTAVCAASVRRFNKEAGERGDTVVL
    CISADLPFAQGRFCTTEGLENVVSLSVFRSPEFGGDYGLTITDGPLKGLLSRAVIVADAAGKVLYTEQVPEIVQEPDYDK
    ALAALA

    >gi|193213024|ref|YP_001998977.1| Rhodanese domain protein [Chlorobaculum parvum NCIB 8327]
    MAKANRNNVKNIAPSEALSMIRKGALLVDVRENREIDRKAFDVEEFMSVPMSKFQSQLHEIPTGRKVIIACHSGSRSGMA
    SKMLANQGHKKVHNMQSGLIRWEREGLPVKKKPSQSPFAWITKMFRRKS

    >gi|193213061|ref|YP_001999014.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chlorobaculum parvum NCIB 8327]
    MSNFDDEMYFEMSMPLLGDDFPELNVQTTHGPMSIPGDLKGSWFVLFSHPADYTPVCTTEFVAFQQRAEKFEEIGCKLIG
    MSVDQVFSHIKWVEWIKDNLNVEITFPIVAANDRIANKLGMLHPGKGTNTVRAVFVGDPEGKVRLVLYYPQEIGRNMDEI
    LRAVTALQISDKNKVAMPADWPNNALLNDRVIIPPATNIKDAEKRKEQHDCYDWWFCHKQLNK

    >gi|193213224|ref|YP_001999177.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chlorobaculum parvum NCIB 8327]
    MSVLVGRPAPDFNAEAVVNGSTFVDSCQLSAYRGKYVVLFFYPLDFTFVCPTELHAFEEKLEEFKKRNVEVLGCSVDSKF
    SHFAWLNTPRNKGGIQGVTYPLISDINKTIAKDYDVLTADGSVALRGLFLIDKEGIVRHQVVNDLGLGRNIDEVIRIVDA
    LQFTEEFGEVCPANWNKGDKTMKPTDEGLKEYFAE

    >gi|193213248|ref|YP_001999201.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Chlorobaculum parvum NCIB 8327]
    MLDIHNPTTDHQDIRDLTIIGGGPTGIFAAFQCGMNNISCRIIESMSQLGGQLAALYPEKHIYDVAGFPEVPAIDLVESL
    WAQAERYNPDVVLGEAVTKYTKLDDGTFETRTNAGNVYRSRAVLIAAGLGAFEPRKLPQLGNIDHLTGSSVYYAVKSVDN
    FKGKRVVIVGGGDSALDWTVGLLKNAESVTLVHRAKEFQGHGKTAHEVEQAKADGLIDVHLQTEVASIEESNGALTHVHL
    RSSNGEEWTVEADRLLILIGFKSNLGPLAGWDLELAENALVVDSHMKTSVDGLYAAGDIAHYPGKLKIIQTGLSEATMAV
    RHSLSYIKPGEKIRNVFSSVKMAKEKKAAEQEKKAE

    >gi|193213306|ref|YP_001999259.1| heavy metal translocating P-type ATPase [Chlorobaculum parvum NCIB 8327]
    MSVTERRNKEKLHCDHCQQEMEYSAAVTAVIDGQTRYFCCHGCLGVYELIHSESLDAFYQQRCDWQPGRPAFGKVDAREF
    EGNVRNDGSSSKIDLLLSGIR
    CASCVWLVEKALARLDGIVSARVNYATHRATIQWRTGEITLETILNTLAGLGYLPRPVR
    HGAQVEAFTEEKRDLLLRFGTAGFFSMQLMLIIAALYAGFFQGIETTYRLTFQIISWALATPVVFYSGWPFISNALRSLR
    NRSLNMDALVALGSLSAYFYSVAMIFTGGEVFFDTSAMIITFILLGRFLEAGSRLKAGSALAALADLQPSEALLVGEDGH
    AAPAPLEQINAGAVIEVLPGGRVPLDGTVTAGESDVDESMLTGESAPVAKAPGSTVYAGTLAITGRLLVSVTGNAHETLL
    SGIIRTVEEAQARKAPIQGVADRVAGWFVPAIILLAAGTFAWWRIDGAPTVTALMTAVSVLVIACPCALGLATPLAILVG
    TTAVSRKGILVKGGDIFETVSKTTTVVLDKTGTITRGKPSVTDTFDYGISNRFMQCCASLEAWSSHPAGQAITDAWLGER
    LPLDGLRVIPGMGVSGKIEGETWLAGSRVLLEKKGVTLDDKCLETTDRLEAEGKTTVLVACNGHVAGLFGLIDDLRDDAE
    RMIEALRAQGLGLMILTGDNAGVARYIAEKCGITQVRSGLDPLGKAEAIRELKRSGETVLMAGDGINDAPALTEADTGVS
    FGTATAVAIDSAGVTIMNDDLTLLDTLVAHSRRCFAIIRQNLAWAFGYNLIALPLAVTGVLHPIVSALLMATSSLVVVSN
    SLRLRKL

    >gi|193213436|ref|YP_001999389.1| glutaredoxin 2 [Chlorobaculum parvum NCIB 8327]
    MRPVVTIYGKPTCCLCDKAMAVLEEARQRTPFEIEKKDISGDFELLERYGLDIPVILINGREAFKHRIDPDRLAELLEGR
    SSLS

    >gi|193213673|ref|YP_001999626.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Chlorobaculum parvum NCIB 8327]
    MQKQVDILVIGGSAAGIVAATTARAFYPDKEVMIVRKEQDAVVPCGIPYIYGTLKGVDQDIIPTGHITEAGVELMIDEVK
    SIDKESKTATTSSGTVISWDKLVIATGSVPKVPEWLPGTGLENVFTIPKDSHYLEQVQHALEKSKKVVIIGGGFIGVEIA
    DELSKKGFDITLVELLPHLLQMAFDEELSVRAEEILADEGVKLRLGCKVERIEGDGAVSAVRLEGGEVLEADLVVLSTGY
    LPNTTLAADAGIKLNELDAIRVDEYMRTEDKDIFAVGDCAEKFSFFTRIVKGLMLASTACSEARIAGMNLYKLSRLRTFG
    GTMSIFSTAIGGTTFAAAGVTEQVAIERGFDIVSAFAQGIDKHPKSLPNVHSQWVKLIVNRESGLVLGGSVMGGASAGEL
    INVIGVIIENKMTIHEVLTLQFGTHPLLTGPPTGYPLLKAAENVARKLRA