Chlamydophila pneumoniae TW 183 uid57997

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|33241569|ref|NP_876510.1| putative disulfide bond chaperone [Chlamydophila pneumoniae TW-183]
    MNKKILVLCTAMFFIVCFGFLIHKKHTILPPKAHIPTNAKHFPTIGNPYAPINITVFEEPSCSACAEFTTEVFPLLKKHY
    IDTGEISFTLIPVCFIRGSKPAAQALLCIYHHDPRQADIDAYMEYFHRILTYPKEEGSHWATPEVLTKLAEGLKINSGRS
    VNPKGLEQCIASGQYNEQIKKNNLYGSQVLGGQLATPTAVVGDYLIEDPTFHEIERAIQHIRQLQAVEGDHDD

    >gi|33241658|ref|NP_876599.1| thioredoxin reductase [Chlamydophila pneumoniae TW-183]
    MIHSRLIIIGSGPSGYTAAIYASRALLHPLLFEGFFSGISGGQLMTTTEVENFPGFPEGILGPKLMNNMKEQAVRFGTKT
    LAQDIISVDFSVRPFILKSKEETYSCDACIIATGASAKRLEIPGAGNDEFWQKGVTA
    CAVCDGASPIFKNKDLYVIGGGD
    SALEEALYLTRYGSHVYVVHRRDKLRASKAMEARAQNNEKITFLWNSEIVKISGDSIVRSVDIKNVQTQEITTREAAGVF
    FAIGHKPNTDFLGGQLTLDESGYIVTEKGTSKTSVPGVFAAGDVQDKYYRQAVTSAGSGCIAALDAERFLG

    >gi|33241778|ref|NP_876719.1| Na(+)-translocating NADH-quinone reductase subunit D [Chlamydophila pneumoniae TW-183]
    MTSKKSYKSYFFDPLWSNNQILIAILGICSALAVTTTVQTAITMGIAVSIVTGCSSFFVSLLRKFTPDSVRMITQLIIIS
    LFVIVIDQFLKAFFFDISKTLSVFVGLIITN
    CIVMGRSESLARHVTPIPAFLDGFASGLGYGWVLLVIGVIRELFGFGTL
    MGFRIIPQFVYASETHPDGYQNLSLMVLAPSAFFLLGIMIWLVNIRDSKKRKR

    >gi|33241779|ref|NP_876720.1| Na(+)-translocating NADH-quinone reductase subunit E [Chlamydophila pneumoniae TW-183]
    MWLGAYTWLNVFGILLQAAFIQNILLANFLGMCSYLACSTRVSTANGLGMSVALVLTVTGSINWFVHAFITGPKALTWIS
    PSLASVNLGFLELIIFIVVIAAFTQILELLLEKVSRNLYLSLGIFLPLIAVN
    CAILGGVLFGITRSYPFIPMMIFSLGAG
    CGWWLAIVILATIKEKLAYSDIPKNLQGMGISFITTGLIAMAFMSLTGIDISKPSAKIQRAPLETEVVENTTNPLKESSS
    KHQPSISKARTQRRSL

    >gi|33241951|ref|NP_876892.1| methylated-DNA-protein-cysteine S-methyltransferase [Chlamydophila pneumoniae TW-183]
    MADDTLIPKLMKNSLSQACSEGLLIAKYPPLQVIVHFDNNLVVKTHLSVAPVFSCLFLGPAAHKAMQEIVLWCSRYANKE
    HPPFSSHFAKDLIPSQYLEILNCVAEIPFGEQQTYAEIAKKTDTHPRTVGAACKQNPFLLFFP
    CHRVVGSHGERNYVLGP
    VIHEILLKFENSY

    >gi|33242016|ref|NP_876957.1| thioredoxin [Chlamydophila pneumoniae TW-183]
    MVKIISSENFDSFIASGLVLVDFFAEWCGPCRMLTPILENLAAELPHVTIGKINIDENSKPAETYEVSSIPTLILFKDGN
    EVARVVGLKDKEFLTNLINKHA

    >gi|33242093|ref|NP_877034.1| hypothetical protein CpB0762 [Chlamydophila pneumoniae TW-183]
    MEKKYYALAYYYITRVDNPHEEIALHKKFLEDLDVSCRIYISEQGINGQFSGYEPHAELYMQWLKERPNFSKIKFKIHHI
    KENIFPRITVKYRKELAALGCEVDLSKQAKHISPQEWHEKLQENRCLILDVRNNYEWKIGHFDNATLPDIQTFREFPEYA
    EKLAQECDPETTPVMMY
    CTGGIRCELYSPVLLEKGFKEVYQLDGGVIAYGQQVGTGKWLGKLFVFDDRLAIPIDESDPDV
    APIAECCHCQTPSDAYYNCANTDCNALFLCCDECIHQHQGCCGEECSQSPRVRKFDSSRGNKPFRRAHLCEISENSESAS
    CCLI

    >gi|33242137|ref|NP_877078.1| 2-cys peroxiredoxin BAS1 precursor [Chlamydophila pneumoniae TW-183]
    MTLSLVGKEAPDFVAQAVVNGETCTVSLKDYLGKYVVLFFYPKDFTYVCPTELHAFQDALGEFHTRGAEVIGCSVDDIAT
    HQQWLATKKKQGGIEGITYPLLSDEDKVISRSYHVLKPEEELSFRGVFLIDKGGIIRHLVVNDLPLGRSIEEELRTLDAL
    IFFETNGLVCPANWHEGERAMAPNEEGLQNYFGTID

    >gi|33242145|ref|NP_877086.1| thiol:disulfide interchange protein [Chlamydophila pneumoniae TW-183]
    MNKFKTYLQTALIAPFFSFPALSGSFSSIQAEEITQQVNHPGAELLSEGSYIPGLQTFRLGIKITASKGSHIYWKNPGEI
    GSPLKISWQLPKGFVVEEEHWPTPKVFEEEGTTFFGYEDSALIVADVRAPEGYTPGQEVELRAQVEWLACGDSCLPGNVD
    LKLTLPYEEKEPSLYPDTHAEFTKTLHAQPRVLENDHSVQVAQGKGNEIILNISKKINATKAWFVSEKADKLFAYAETSY
    SGGTGTAWRLKVKNLSGVQKNEKLHGILLLADHTGRPVESLTIHSEVLGQTGSAVAGLSQYITILIMAFLGGVLLNIMPC
    VLPLVTLKVYGLIKSAGEHRSSVIANGLWFTLGVVGCFWGLAGVAFILKVLGHNIGWGFQLQEPMFVATLIIVFFLFALS
    SLGLFEMGTMFANLGGKLQSSEMKSSNNKAVGAFFNGILATLVTTPCTGPFLGSVLGLVMSLSFLQQLLIFTAIGLGMAS
    PYLVFSVFPKMLSVLPKPGGWMSTFKQLTGFMLLVTVTWLVWIFGSETSTTSVVVLLGGLWLAGLGAWILGRWGTPVSPK
    KQRVCASLLFFAFLGGAISVSGLASHYFAEPQQTVSVNEDSLWQPFSLEKLAQLRAQGRPVFVNFTAKW
    CLTCQMNKPVL
    YGDAVQKMFETHGIVTLEADWTRKDPGITEELARLGRASVPSYVYYPGDNSAPVVLPEKITQNLLEDVVSRFVR

    >gi|33242193|ref|NP_877134.1| dihydrolipoamide dehydrogenase [Chlamydophila pneumoniae TW-183]
    MTQEFDCVVIGAGPSGYVAAITAAQSKLRTALIEEDQAGGTCLNRGCIPSKALIAGANVVSHITHAEQFGIHVDGYTIDY
    PAMAKRKNTVVQGIRQGLEGLIRSNKITVLKGTGSLVSSTEVKVIGQDTTIIKANHIILATGSEPRPFPGVPFSSRILSS
    TGILELEVLPKKLAIIGGGVIGCEFASLFHTLGVEITVIEALDHILAVNNKEVSQTVTNKFTKQGIRILTKASISAIEES
    QNQVRITVNDQVEEFDYVLVAIGRQFNTASIGLDNAGVIRDDRGVIPVDETMRTNVPNIYAIGDITGKWLLAHVASHQGV
    IAAKNISGHHEVMDYSAIPSVIFTHPEIAMVGLSLQEAEQQNLPAKLTKFPFKAIGKAVALGASDGFAAIVSHEITQQIL
    GAYVIGPHASSLIGEMTLAIRNELTLPCIYETVHAHPTLSEVWAEGALLATNHPLHFPPKS

    >gi|33242289|ref|NP_877230.1| putative thioredoxin disulfide isomerase [Chlamydophila pneumoniae TW-183]
    MKFWLQGCAFVGCLLLTLPCCAARRRASGENLQQTRPIAAANLQWESYAEALEHSKQDHKPICLFFTGSDWCMWCIKMQD
    QILQSSEFKHFAGVHLHMVEVDFPQKNHQPEEQRQKNQELKAQYKVTGFPELVFIDAEGKQLARMGFEPGGGAAYVSKVK
    SALKLR