Chlamydophila pneumoniae J138 uid57829

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|15835763|ref|NP_300287.1| disulfide bond chaperone [Chlamydophila pneumoniae J138]
    MNKKILVLCTAMFFIVCFGFLIHKKHTILPPKAHIPTNAKHFPTIGNPYAPINITVFEEPSCSACAEFTTEVFPLLKKHY
    IDTGEISFTLIPVCFIRGSKPAAQALLCIYHHDPRQADIDAYMEYFHRILTYPKEEGSHWATPEVLTKLAEGLKINSGRS
    VNPKGLEQCIASGQYNEQIKKNNLYGSQVLGGQLATPTAVVGDYLIEDPTFHEIERAIQHIRQLQAVEGDHDD

    >gi|15835849|ref|NP_300373.1| thioredoxin reductase [Chlamydophila pneumoniae J138]
    MIHSRLIIIGSGPSGYTAAIYASRALLHPLLFEGFFSGISGGQLMTTTEVENFPGFPEGILGPKLMNNMKEQAVRFGTKT
    LAQDIISVDFSVRPFILKSKEETYSCDACIIATGASAKRLEIPGAGNDEFWQKGVTA
    CAVCDGASPIFKNKDLYVIGGGD
    SALEEALYLTRYGSHVYVVHRRDKLRASKAMEARAQNNEKITFLWNSEIVKISGDSIVRSVDIKNVQTQEITTREAAGVF
    FAIGHKPNTDFLGGQLTLDESGYIVTEKGTSKTSVPGVFAAGDVQDKYYRQAVTSAGSGCIAALDAERFLG

    >gi|15835962|ref|NP_300486.1| Na(+)-translocating NADH-quinone reductase subunit D [Chlamydophila pneumoniae J138]
    MTSKKSYKSYFFDPLWSNNQILIAILGICSALAVTTTVQTAITMGIAVSIVTGCSSFFVSLLRKFTPDSVRMITQLIIIS
    LFVIVIDQFLKAFFFDISKTLSVFVGLIITN
    CIVMGRSESLARHVTPIPAFLDGFASGLGYGWVLLVIGVIRELFGFGTL
    MGFRIIPQFVYASETHPDGYQNLSLMVLAPSAFFLLGIMIWLVNIRDSKKRKR

    >gi|15835963|ref|NP_300487.1| Na(+)-translocating NADH-quinone reductase subunit E [Chlamydophila pneumoniae J138]
    MWLGAYTWLNVFGILLQAAFIQNILLANFLGMCSYLACSTRVSTANGLGMSVALVLTVTGSINWFVHAFITGPKALTWIS
    PSLASVNLGFLELIIFIVVIAAFTQILELLLEKVSRNLYLSLGIFLPLIAVN
    CAILGGVLFGITRSYPFIPMMIFSLGAG
    CGWWLAIVILATIKEKLAYSDIPKNLQGMGISFITTGLIAMAFMSLTGIDISKPSAKIQRAPLETEVVENTTNPLKESSS
    KHQPSISKARTQRRSL

    >gi|15836128|ref|NP_300652.1| methyltransferase [Chlamydophila pneumoniae J138]
    MADDTLIPKLMKNSLSQACSEGLLIAKYPPLQVIVHFDNNLVVKTHLSVAPVFSCLFLGPAAHKAMQEIVLWCSRYANKE
    HPPFSSHFAKDLIPSQYLEILNCVAEIPFGEQQTYAEIAKKTDTHPRTVGAACKQNPFLLFFP
    CHRVVGSHGERNYVLGP
    VIHEILLKFENSY

    >gi|15836191|ref|NP_300715.1| thioredoxin [Chlamydophila pneumoniae J138]
    MVKIISSENFDSFIASGLVLVDFFAEWCGPCRMLTPILENLAAELPHVTIGKINIDENSKPAETYEVSSIPTLILFKDGN
    EVARVVGLKDKEFLTNLINKHA

    >gi|15836266|ref|NP_300790.1| hypothetical protein CPj0734 [Chlamydophila pneumoniae J138]
    MEKKYYALAYYYITRVDNPHEEIALHKKFLEDLDVSCRIYISEQGINGQFSGYEPHAELYMQWLKERPNFSKIKFKIHHI
    KENIFPRITVKYRKELAALGCEVDLSKQAKHISPQEWHEKLQENRCLILDVRNNYEWKIGHFDNATLPDIQTFREFPEYA
    EKLAQECDPETTPVMMY
    CTGGIRCELYSPVLLEKGFKEVYQLDGGVIAYGQQVGTGKWLGKLFVFDDRLAIPIDESDPDV
    APIAECCHCQTPSDAYYNCANTDCNALFLCCDECIHQHQGCCGEECSQSPRVRKFDSSRGNKPFRRAHLCEISENSESAS
    CCLI

    >gi|15836311|ref|NP_300835.1| thio-specific antioxidant (TSA) peroxidase [Chlamydophila pneumoniae J138]
    MTLSLVGKEAPDFVAQAVVNGETCTVSLKDYLGKYVVLFFYPKDFTYVCPTELHAFQDALGEFHTRGAEVIGCSVDDIAT
    HQQWLATKKKQGGIEGITYPLLSDEDKVISRSYHVLKPEEELSFRGVFLIDKGGIIRHLVVNDLPLGRSIEEELRTLDAL
    IFFETNGLVCPANWHEGERAMAPNEEGLQNYFGTID

    >gi|15836319|ref|NP_300843.1| thio:disulfide interchange protein [Chlamydophila pneumoniae J138]
    MIAPFFSFPALSGSFSSIQAEEITQQVNHPGAELLSEGSYIPGLQTFRLGIKITASKGSHIYWKNPGEIGSPLKISWQLP
    KGFVVEEEHWPTPKVFEEEGTTFFGYEDSALIVADVRAPEGYTPGQEVELRAQVEWLACGDSCLPGNVDLKLTLPYEEKE
    PSLYPDTHAEFTKTLHAQPRVLENDHSVQVAQGKGNEIILNISKKINATKAWFVSEKADKLFAYAETSYSGGTGTAWRLK
    VKNLSGVQKNEKLHGILLLADHTGRPVESLTIHSEVLGQTGSAVAGLSQYITILIMAFLGGVLLNIMPCVLPLVTLKVYG
    LIKSAGEHRSSVIANGLWFTLGVVGCFWGLAGVAFILKVLGHNIGWGFQLQEPMFVATLIIVFFLFALSSLGLFEMGTMF
    ANLGGKLQSSEMKSSNNKAVGAFFNGILATLVTTPCTGPFLGSVLGLVMSLSFLQQLLIFTAIGLGMASPYLVFSVFPKM
    LSVLPKPGGWMSTFKQLTGFMLLVTVTWLVWIFGSETSTTSVVVLLGGLWLAGLGAWILGRWGTPVSPKKQRVCASLLFF
    AFLGGAISVSGLASHYFAEPQQTVSVNEDSLWQPFSLEKLAQLRAQGRPVFVNFTAKW
    CLTCQMNKPVLYGDAVQKMFET
    HGIVTLEADWTRKDPGITEELARLGRASVPSYVYYPGDNSAPVVLPEKITQNLLEDVVSRFVR

    >gi|15836366|ref|NP_300890.1| dihydrolipoamide dehydrogenase [Chlamydophila pneumoniae J138]
    MTQEFDCVVIGAGPSGYVAAITAAQSKLRTALIEEDQAGGTCLNRGCIPSKALIAGANVVSHIKHAEQFGIHVDGYTIDY
    PAMAKRKNTVVQGIRQGLEGLIRSNKITVLKGTGSLVSSTEVKVIGQDTTIIKANHIILATGSEPRPFPGVPFSSRILSS
    TGILELEVLPKKLAIIGGGVIGCEFASLFHTLGVEITVIEALDHILAVNNKEVSQTVTNKFTKQGIRILTKASISAIEES
    QNQVRITVNDQVEEFDYVLVAIGRQFNTASIGLDNAGVIRDDRGVIPVDETMRTNVPNIYAIGDITGKWLLAHVASHQGV
    IAAKNISGHHEVMDYSAIPSVIFTHPEIAMVGLSLQEAEQQNLPAKLTKFPFKAIGKAVALGASDGFAAIVSHEITQQIL
    GAYVIGPHASSLIGEMTLAIRNELTLPCIYETVHAHPTLSEVWAEGALLATNHPLHFPPKS

    >gi|15836459|ref|NP_300983.1| thioredoxin disulfide isomerase [Chlamydophila pneumoniae J138]
    MKFWLQGCAFVGCLLLTLPCCAARRRASGENLQQTRPIAAANLQWESYAEALEHSKQDHKPICLFFTGSDWCMWCIKMQD
    QILQSSEFKHFAGVHLHMVEVDFPQKNHQPEEQRQKNQELKAQYKVTGFPELVFIDAEGKQLARMGFEPGGGAAYVSKVK
    SALKLR