Actinosynnema mirum DSM 43827 uid58951

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|256374220|ref|YP_003097880.1| OsmC family protein [Actinosynnema mirum DSM 43827]
    MATVRKATTHWKGSLMEGDGTVTLESSGVGTYDVSWPSRAEQANGKTSPEELIAAAHSSCYSMALSHGLAQAGTPPQQVD
    TSAEVTFKPGTGITGIHLTVRAVVPGLEADAFAEAAETAKKN
    CPVSQALAAVEITLDAALA

    >gi|256374234|ref|YP_003097894.1| Rhodanese domain protein [Actinosynnema mirum DSM 43827]
    MSRVTVPSVEVSDVPAELPEGAVLLDVREVDEWAAGHAPGAVHIPMSELAGRLGEVPEADVVYVVCRMGGRSARVTEYLN
    ANGWDAVNVDGGMQTWSTQGRPMVGELPDVEPEVI

    >gi|256374380|ref|YP_003098040.1| OsmC family protein [Actinosynnema mirum DSM 43827]
    MNVLYTAEAIAVGDGRNGEVRSSDGVIDEQLAMPKELGGPGGDKTNPEQLFAAGYAACFHSALKRVAGQAKADITDSTVT
    AKVGIGPNDQGGFGLTVELAVHIPGADEAAAHKLVETAHQV
    CPYSNATRGNIEVALTTTV

    >gi|256374411|ref|YP_003098071.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Actinosynnema mirum DSM 43827]
    MSAAARWSVVVLVLAVAGVVALWPRGEDPASPVIPQPQRDTSQRADLGVARNKAALRPCDQFSGNSASPASANAASPSPA
    SPSAGPTSTSAGPEALRGATAVCLGDGERVDAATALSGRVLVNFWASW
    CAPCREELRVLDDYSQRPGAIPVLGVQVKSGE
    ADGLDLLSRIGVHLPSLVDDSEALLRAFKVPPTLPASFLVGADGSITPVTDPLVFTSVDQVREVVG

    >gi|256374861|ref|YP_003098521.1| protein of unknown function DUF255 [Actinosynnema mirum DSM 43827]
    MTNRLASATSPYLLQHADNPVHWWEWSPEAFAEARERDVPVLLSVGYAACHWCHVMAHESFEDAETAEYLNAHFVNVKVD
    REERPDVDAVYMSVTQALSGHGGWPMTCFLTPDGEPFYAGTYYPPTPRPGMPSFRQVLEAIEHAWREQGDEVRASAAGIV
    AQLAHTPLPEAAVDADVLDGAVVSLLGHLDRGNGGFGGAPKFPPSMALEFLLRDHERTGSVQALSMARLTCDAMASGGIY
    DQLGGGFARYSVDASWVVPHFEKMLYDNALLLRAYTHLARLVPDEPRYREVVEDTAGFLLRDLLTPEGGFAASLDADTGG
    VEGATYAWTPAQLVEVLGEEDGARAAALYGVTEEGTFEHGASTLRLLGGSDPALKAALLAARAEREQPGRDDKVVTSWNG
    LAVAALAEAGAVLGVRAWVEAAERAAGLLLDLHVVDGRLLRTSRDGRAGGAAGVLEDHGCLADGLLALHQVTGTARWLTA
    ACDVLDVALARFAGDEPGVWYDTADDAETLVHRPADPADNASPSGASSLAGALLTASALGAPRAGEYREAAERAVARAGL
    LAAREPRFAGHWLSVAEALAMGPVQVALVGGSPSLLAAAWSGVHGGGVVVSGEPDTAPLLADRPLVGGEPAAYVCRGFVC
    DRPVTTVEDLTAALVAR

    >gi|256374883|ref|YP_003098543.1| methylated-DNA/protein-cysteinemethyltransferase [Actinosynnema mirum DSM 43827]
    MTAFTSTVDTPIGPFTTVVAGDGAVLASGWTASLDELMPQVSASLKPEEIKERRDLGEVTRAVRAYHSGELGAVAEVPVR
    QRAGAFTEQAWDALRLVPAGQPVSYARYAELAGRPAAVRAAATACAKNAAALFVP
    CHRVVRTGGAIGNFRWGVDAKRWLL
    EHEG

    >gi|256374980|ref|YP_003098640.1| UBA/THIF-type NAD/FAD binding protein [Actinosynnema mirum DSM 43827]
    MALPPLVEPAAELTKEEVARYSRHLIIPDVGVDGQKRLKNAKVLVVGAGGLGSPALLYLAAAGVGTLGVVDFDVVDESNL
    QRQVIHGQSDIGKPKAESARESVAEINPFVKVVLHQAQLTSENALEIFRDYDLILDGTDNFATRYLVNDAAVLLGKPYVW
    GSIFRFEGQVSVFWEDAPNGQGLNYRDLYPEPPPPGMVPS
    CAEGGVLGVLCASIGSIMVTEAIKLLTGIGDPLLGRLMVY
    DALEMSYRTIRIRKDPESPKITELIDYEAFCGVVSDEAQQAAAGRTITPLELKQKQDAGDDFVLVDVREPHEYEIVRIPG
    SVLIPKDRILSGEALAELPQDKPIVLH
    CKSGARSAEALAALHRAGFADAVHVGGGVLAWARQIDQSLPTY

    >gi|256375100|ref|YP_003098760.1| protein-disulfide isomerase-like protein [Actinosynnema mirum DSM 43827]
    MGGAERNARKKKQAQRAAVSAVAASRKASDRNKVVAGVAIVVVLALVVIGGVMWQGASKSTENAQLVATGAKSTNAPVER
    AGGVVTVGRPDADVTIDVYEDFL
    CPVCGVFKEKYADQIRTHVEAGELRVNYHLLPMLIRMSSPEGYSRDAANAALCVADE
    GKFSEYHDRLYAQQPEEGEAGWTKDQLKQLAVDLGVTSEGFKSCVDNGTHEAEAKAELDKANATDFFKGTPTVTKDGQEL
    DALGDPEWLSKLFA

    >gi|256375165|ref|YP_003098825.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Actinosynnema mirum DSM 43827]
    MTDNRLAPGDEAPAFTLPDSSGKPVSLSDYLGRSVVVYFYPAAGTPGCTKQACDFRDSTGALAESGYEVVGVSPDKPEKL
    ARFAEAEGLTFPLLSDEDKTVLTAWGAFGEKKNYGRVVQGVIRSTFLVGPDGKVVKAMYNVRATGHVAKLLRELPAS

    >gi|256375284|ref|YP_003098944.1| hypothetical protein Amir_1143 [Actinosynnema mirum DSM 43827]
    MSSAGSTKVDFYFDPLCPFAWITSRWILEVEKHRDLDLEFHVMSLSVLNEGRDLEPQYREMMDKGWGPVRVAIAAEKAHG
    NAVLRDLYTALGTRIHNEGNKDWDEVIKLALEEVGLPAELAAAATSTEHDEELKASHHRGMDPVGMDVGTPTIHIDGVAF
    FGPVLTKIPRGEDAVKVFDGARLLAGFPEFFELKRTRTGSLDFS

    >gi|256375453|ref|YP_003099113.1| pyridine nucleotide-disulphide oxidoreductase dimerization region [Actinosynnema mirum DSM 43827]
    MTGDNFDVIVIGGGPVGENAAARTAAAGLRTALVEADLLGGECSYWACMPSKALLRPGHALAAAKRVPGVPVGDKLDPAA
    VLARRDSFTSHWDDAGQVSWAEGAGIVVVRGRGSLAGERRVDVDGRVLTASRAVVVCTGSEVSLPPLDGLDSTPHWTSRE
    ATSAKEVPRSLVVLGGGVVGVEMAQAWARLGSEVTLVLSGERPLPKFEAFAGDLVAEGLREDGVRIVTGARARAVAAVDG
    GVRLTGDGVDVTAAHLLVATGRKPATTGIGVEEFGFEAGRALPVDDAGRVRGVDWLYAAGDVTGRAMLTHQGKYAARAVG
    TAIATGAVDPQPWTAAVATADHTAVPQVVFTDPEVAFVGRTEAQAREAGLDVRVVDLDLAVAGSSLHADGYRGKARMVVD
    ESTRTLVGVTFAGPDTAELLHAATVAIVGGVTVDRLWHAVPAYPTISEVWLRLLEAYGL

    >gi|256375474|ref|YP_003099134.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Actinosynnema mirum DSM 43827]
    MIEIGAEAPDFTLADSNKQKVALSSFRGSKSVLLVFYPFAFSGTCTGELCRVRDELADYEAAGVQVIGVSVDTPFSLKAW
    AKQEGYRFPLLSDFWPHGEVARAYGVFSEGAGFALRGTFLIDTAGVVRFAQVNEPGEARDQESWKRAVAALA

    >gi|256375489|ref|YP_003099149.1| dihydrolipoamide dehydrogenase [Actinosynnema mirum DSM 43827]
    MTDTSADLVILGGGSGGYACAFRAAELGLSVILVEKDKLGGTCLHRGCIPTKALLHSAEVADNAREGEQFGVKSSLAGID
    MAGVNSYKDGVISRLYKGLQGLAKANKVTMVQGAGTFVGPNAVEVDGVKYTGKNVVLATGSYARSLPGLEIGGRVITSDQ
    ALNLDHVPEKVVVLGGGVIGVEFASVWASFGADVTIVEALPRLVPAEDEYASKQLERAFRRRGIKFKTGVKFTGATQSDT
    GVSVSLENGDVLDADLLLVAVGRGPNSAGHGYEEAGIEIDRGFVTTDERLRTNLPDVYAVGDIVRGLQLAHRGFQQGIFV
    AEEIAGQNPKVIDEAGIPRVTYCKPEVASVGLSEAAAKEKYGSVETFVYDLAGNGKSQILKTAGGIKLVKAPEGPVVGVT
    MVGERVGELIGEAQLIYGWEAYPEDVAPLIHAHPTQTEALGEAFLALAGKPLHVHG

    >gi|256375502|ref|YP_003099162.1| iron-sulfur cluster assembly accessory protein [Actinosynnema mirum DSM 43827]
    MTTAQDSAVPTPDAPPTHGVTLTDAAASKAKALLDQEGRDDMHLRIAVQPGGCAGLRYQLFFDERSLDGDALRDFEGLKV
    AVDRMSAPYVEGAVIDFVDTIEKQGFTIDNPNAGGSCACGDSFH

    >gi|256375603|ref|YP_003099263.1| Rhodanese domain protein [Actinosynnema mirum DSM 43827]
    MHPLISTEALAVALADERPPVVLDVRWRLGGPPARQDYEVGHVPGAVHTDLDAALAAPPGPEGRHPLPEVAVLERALRAA
    GVREGVPVVAYDDGDGSVAARAWWLLRWAGHDQVAVLDGGYAAWSAEGRPVTAEEPEPEEGDVVVRPGRMPVVDADGAAE
    LAREGVLLDARAGARYRGEVEPVDPKAGHIPGAVSAPSAEHAGADGRWLPARTLAARFQALGVTGDRPVGAY
    CGSGVTAS
    SVVLALEAAGLTTRDTPALLYPGSWSNWSAQDRPVATGDQPG

    >gi|256375700|ref|YP_003099360.1| methionine-R-sulfoxide reductase [Actinosynnema mirum DSM 43827]
    MEPVTGTTPKVVHSELEWREILTPKEYAVLREAGTEPAWVGEYTDTKSEGVYDCRACGAELFRSDTKFDSHCGWPSFFSP
    LAADRVILREDRALGMVRTEVLCSACHSHLGHVFEGEGYATPTDQRY
    CINSISLRLVEKPSV

    >gi|256375910|ref|YP_003099570.1| thioredoxin [Actinosynnema mirum DSM 43827]
    MATVELTTENFDEVVGGSDMVLVDFWASWCGPCRQFAPVYDKAAEKHSDIVFGKVDTEDQQQLAQAFQVRSIPTLMIVRD
    GVVLYAQPGALPETALEDLIKQAREVDMDEVRKQVAEQQAEETDGEPATKG

    >gi|256376029|ref|YP_003099689.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Actinosynnema mirum DSM 43827]
    MENTGGTQEHDVVVIGGGAAGLSGAVALARSRRSVLVIDSGAPRNAPAEHMHNFLSRDGLPPRELLALGRDEVVSYGGRI
    VSGRVGAVERDGDGFLVRASSGVVRARKVLVATGLVDELPEVPGLRERWGRDVLH
    CPFCHGWEVRDQRIGVLATGPMAAH
    QVMLFRQLSDRVVLLRHTGPALGELAEEQLRARGVETVDGVVEQVVSVADRLVGVRLAGDRDVALDALVVAPRFVARADF
    LAPLGLHPVDEVRDGHVIGSAVPSGPAGATAVPGVRIAGNVTDLSGQVITSAAAGLMAGAALNGELVNDETAAAVAALRE
    PFSHEAERRLAAVVAGGRRHGL

    >gi|256376717|ref|YP_003100377.1| DSBA oxidoreductase [Actinosynnema mirum DSM 43827]
    MPVSAVRVEVWSDIVCPWCYIGKRRFEGALAEFDGEVEVEWRSFQLDPNAPVGRFLPTPEHLSAKMGASREQVEGMMGQV
    TAVAAEVGLEYDLMNSVSLNTFDAHRVLHLAKSHGLGTVAHERLMRANLVEARTLDTPTLVELAAGIGVPAQETERVLAG
    DEYAHEVREDFSQARRYGVSGVPFFVLNSAYGVSGAQPTEVFAQALRQAAQG

    >gi|256376852|ref|YP_003100512.1| periplasmic binding protein [Actinosynnema mirum DSM 43827]
    MPRTRPTAPALTAVALSALLLSSCGASVRPQAEAPQALGYPVTVTNCGQELTFDRAPERVVAYDSGIVETMFALGLTDRL
    AGYVMSGSKNNDIEGSPWKADYERAPRLGVDRISKESILQAGADFVYAGWNYGFSEDRGLTPAHLDALGVRSYVLSES
    CR
    NGVGSTSRGTMAPLDALYTDLRNLGKVFGVSERAEQLVTEYREVVRQAEATVPADRPRPKVFLYDSGNDKPFTGGKYAAS
    NEIITRGGGEDVMSGVLDSWTTVTWESVVEANPDVIVINDYDVPSAEDKRRFLETYPPLAQVPAVKNGRFLVLPYAALVQ
    GPRNPAAIRTVADYLNGL

    >gi|256376888|ref|YP_003100548.1| heavy metal translocating P-type ATPase [Actinosynnema mirum DSM 43827]
    MSAAVAVADGPVELVVSGMTCAACATRVERKLNKLDGVRASVNYATERAVVHLPEGMDARDAVEAVRGAGYDARVRRRAE
    DDRAGHTAAVNDLRRRLVVAAVLAIPLGNLSITLALVPSLRFTGWEALCALLAVPVVFYSAWPFHRAAARTLRHGSSSMD
    TLVSIGVLASFGWAVWSMQAGSSGPGYWLGFGVTDGGADAVYLDVAAGVTTFLLAGRYFETRSRRNAVGLLTALADLAAK
    DARVLRDGVEHAVPAALLKVGELFVMRPGEALPADGVVVEGASTVDTSAMTGESVPVEVAEGSRVVGGTVNRTGRVVVRA
    TEVGANTQLAQMSALAEQAAQRKAGVQRLVDRVCAVFVPVVLVISLATLLGWLATGHTAREAFTSAVAVLIIACPCALGL
    ATPTALMVGVARAAGLGVLVKGPRALEATRAVDTVVLDKTGTVTTGRMSVVASVGFGGASSGEALRWAGAVESASEHPIA
    VAIAAGGGFPAVRGFEALVGAGARGEVEGAEVVVGSAALMAELGVTVPEQAGSWLASLGPATGVLVARGGGVVGGIAVRD
    SVRPSAASAVERLHRMGLRTVLLTGDGAAAALAVAEEIGVREVRAEVRPADKAAVVEELRAAGRRVAVVGDGVNDGPALA
    SADLGMAVARGSDVAAQASDVVLVREDLHAVPDAIELAARTLSTIRGNLVWAFGYNAAAIPLAALGLLNPLIAAAAMSLS
    SVLVVTNSLRLRNFRPGGR

    >gi|256377366|ref|YP_003101026.1| Methyltransferase type 11 [Actinosynnema mirum DSM 43827]
    MTPTPEAVGRLYDDLLEAELEGGAADPNLHIGYWDTPDSPVPRAEAVVRFTDEHVRRLHVTTGDRVLDMGCGVGGPALRA
    VDLTGAHVTGISISAAQITHATHLAKSAGHADNTKFLHADAMALPFPDSSFDAVMAIESLIHMPDRERVLNEARRVLRPG
    GRLVLTELFERAPRPTRRHPAITEF
    CRASMVSLPNADDYPALLHRAGLRLRELLDITDHTVQRNFRELADLVGDAKGLLF
    HPRDLVGVPEFGCFLAVAEHP

    >gi|256377991|ref|YP_003101651.1| hypothetical protein Amir_3938 [Actinosynnema mirum DSM 43827]
    MVSVETTGKTDLDFSFDPVCPFAWMTSKWVRIVQARRGSAVDWRFISLRLINSHVDYDSHFPPEYEARHTAGLRLLRVAS
    AVRERHGREAVRPLYAALGARIMESAPDAGRAPGWQGAPELAADALAEAGLPTSLAESLDDASRDAEIQAESDEALSLTG
    KDVGTPILRFAPPNGTALFGPVISRLPDEDQAVALWDHVAALAAFPGFAELKRSLREQPQLPSFGVTAQETGPVEDWHAG
    SRRLKK

    >gi|256378120|ref|YP_003101780.1| alkylhydroperoxidase like protein, AhpD family [Actinosynnema mirum DSM 43827]
    MAHIDLEDVDESLFPGITGLMRYRPETAGPLGELAEVLLRAPNSLSPGERELIAAYVSGRNRCTFCCDSHAAFAAAQLDE
    GTALVDRVLADLELAPVPEKLRALLRIAGAVQESGRAVTPDLVRRARELGATEVEIHDTVLIAAAFCMFNRYVDGLGTLV
    ADDPEHYEVAARRIVAEGYLGLGRGANGSQT

    >gi|256378140|ref|YP_003101800.1| uncharacterized peroxidase-related enzyme [Actinosynnema mirum DSM 43827]
    MDATTEVRVPMVEEAQATGRVAELYAEIKQATGLPFVPDMFRLTSSRPDLLEAVVAGYKGMYLGGVLPRQTRELISAWTS
    KVNQCPY
    CVGTHNFFFRAFGGPEETAKAVETASGVDELPVDERTRVLLRLVTKVSREAYKITEEDWRVAGEAGWSREELL
    EAFFTASMFNFITRMVDGLGLGYSVAASRVSQQPVSQQPVSQQAAPGGGDR

    >gi|256378145|ref|YP_003101805.1| hypothetical protein Amir_4103 [Actinosynnema mirum DSM 43827]
    MVLRGVVSAGLRGLSTAQVRRVRPVRHGAADGRVARVYRELERDFGVLAPPVALHSPAPDVLAAVWLVLRETLLVPGRAP
    RVVKEAVSTAVSEANRCPF
    CVTMHSSVLDDLVVRGNPGGAASAAAEWAGAAAFAGSTAPAPFPAEQAPEVLGTAVVLHHL
    NRMVNLFLGALPLPPGAPAASMVVVRRVLVRLIQAAGRSGPMRGASLDLLPEADLPADLAWAGADPVLGQAFARAAGALD
    AAGRRSVPVGARELVLERLAGWDGRAPGVSRAWAEEAVAGLPAPERAAGRLALLTALAAYQVDDAAVAAFREVDREDRAL
    VELTAWASMAAARRIGSWAPLP

    >gi|256378199|ref|YP_003101859.1| peptide methionine sulfoxide reductase [Actinosynnema mirum DSM 43827]
    MTAVTERAVLAGGCFWGMEDLFRRHPGVLDTRVGYTGGSVPNATYRNHAGHAEAIEIVYDPALLSYRQVLEFFFQIHDPT
    TLDRQGNDIGTSYRSAIFYDTDEQKAVAEQVIGEVDASRRWPGKVVTEVTRSSEFWEAEPEHQDYLVRYPDGYTCHYVRP
    EWQLGER

    >gi|256378253|ref|YP_003101913.1| Rhodanese domain protein [Actinosynnema mirum DSM 43827]
    MSAPVKDDVKDKVADYLEAALGKPVDLGALPDDAPLGVLGLDSLTTIGVLVALLEDAGVDLGEYADSLVTPSTLGDLYAL
    ADRFAADPEPETTTEAQPQGGTGMTGDQRSQLDFYRDKLAYEIDSADLEDALAAGQDIVVVDGRSSESYAHEHIPGAISV
    PHRSISQESLSGLSKAPLYVAYCDGIG
    CNASTKTAVKLATAGFRVKELIGGLDWWKRDNHPTEGHAGRRVEPSGAACGCA
    G

    >gi|256378345|ref|YP_003102005.1| Rhodanese domain protein [Actinosynnema mirum DSM 43827]
    MTVIISATELHRRFPRFRVLDVRWALGAPDGRPAYLSGHLPGAVHVDLEAHLAGPRGPGDGRHPLPGLDAVQSALRGWGV
    NVGDQVVVYDDSGNLAAARAWWVLRDAGIDVRLLDGGLAAWVAGGFPVERGDVVPTPGDVVVSENRLARITTDEAATWPA
    RGVLLDARAGERYRGEVEPVDPGAGHVPGAVSAPTGENLAPDGTFLAAPELARRFAVLGVTPGKPVAVY
    CGSGVTAAHTV
    AALAIAGIDAALYPGSWSQWSSDPDRPVEVGA

    >gi|256378453|ref|YP_003102113.1| uncharacterized peroxidase-related enzyme [Actinosynnema mirum DSM 43827]
    MSRVKLIDAQTATGEAKPLLDQVTGAFGVTPAMFKAVANSPAALKMMWAGFGALGEGKLGARLGEQIAVLVADRNACEYC
    LAAHTALGRKAGVSSEDMRQAQAGHSHDPRTRAALEFSEKLVRERAQVTDADVDALRAVGFDDEAIVELIAHVALNLFTN
    YVNVALGVPVDFPKVVLRKAV

    >gi|256378810|ref|YP_003102470.1| protein of unknown function DUF395 YeeE/YedE [Actinosynnema mirum DSM 43827]
    MSTTTETPSDQRRLPTFPTSCAAPVPRPEEPVRVVPLAVASLIAVALTGYVWTAHGAKSGVLLLLGLGLGLALFHSRFGF
    TSAWRQLVAVGNGAGVRAHSLLLGTAATLVALIVSTGSGLFGSAPRASAGPIGLALFVGALLFAVGMQLGGACASGTLFA
    VGSGQSTILLTLFGFIVGSVVYTAAFPVFDGWPSVPGVLLSDHVGWFGSWALTIAALGLIVLATWFVQKRRNPPPADVAP
    TATGLARVLRGSWPLLVGAVVLGVLAGAVFLVSGGIWGVTFAFALWGAKFLQLIGLHPETWEFWRSASNAKALAGSVWTD
    KTTLTDVGIMIGAAIAAALAGAWKLHTSIPWRTALAAVLGGVLMGVGARLAGG
    CNIGAYLGGISTGSLHGWLWGLFALGG
    TWIGLRLRPLFGLGVPKAADSVC

    >gi|256379126|ref|YP_003102786.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Actinosynnema mirum DSM 43827]
    MKPGDPVNDFTLPDQDGEPRTLSALLADGPVVLFFYPSAMTSGCTAESCHFRDLAAEFAQAGAQRVGISTDSVARQKQFA
    DINSFDYPLLSDADGAVAEAFGVKRRFGPLPVKRHTFVIGTDLTVLEVIKSEFAMNAHADKALAVLRERG

    >gi|256379466|ref|YP_003103126.1| pyridine nucleotide-disulphide oxidoreductase dimerization region [Actinosynnema mirum DSM 43827]
    MSSEYDYDLVVIGSGPGGQKAAIAGAKLGKRVAIVDKADMVGGVCVNTGTIPSKTLREAVMYLTGMSQRELYGASYRVKE
    DITISDLLARTQHVIGHEVQVVRAQLHRNQVDLLTGTGSFTGPHSVAVEGAHRGEHRVISGEKIVIATGTRPARPSQVDF
    DEARVLDSDEVLQLDTIPSSLVVVGAGVIGIEYASMFAALGSRVTVVEQRERMLDFCDSEIVESLKFHLRDLAVTFRFGE
    KVVDVSVSEQGTVTTLASGKRIAAEAVMYSAGRQGCTESLNLEAAGLEADHRGRLSVDGSYRTSVEHIYAVGDVIGFPAL
    AATSMDQGRLAAYHAFGETANELSGLQPIGIYTIPEISYCGATEAELTSSSVPYEVGLARYRELARGQIVGDAYGMLKLL
    VSTEDRKLLGVHLFGTGATDLVHIGQAVMACGGTVDYLVDTVFNYPTLSEAYKVAALDATNKIRALGRFGG

    >gi|256379740|ref|YP_003103400.1| glutaredoxin [Actinosynnema mirum DSM 43827]
    MGEIVVYSADWCGDCRRAKAWFRENGVPFTEVDVEHDEVARERAVGIAGGRKNIPVVVLADGTVLVEPTNTQLASAIAVE
    G

    >gi|256379873|ref|YP_003103533.1| mycothione reductase [Actinosynnema mirum DSM 43827]
    MRHFDLVVIGTGSGNSIVDEAFAAWDVAIVEKGVFGGTCLNVGCIPTKMFVHTADLAAGPASAARFGVDASLDGVRWTDV
    RDRIFGRVDPIAEGGRRWRESGSANTTVFSGTARFTGPKTLDTGAGETITADRFVIAAGSRPVVPDVPGLAETGFHTSDT
    VMRLDRLPRRMVILGSGFVATEFAHVFSSFGVEVTLVARSGALLRAEDDAVSARFTELASAKWDVRLDRRAVRAERVDGV
    ARLHLEGPDGPEVVEAEELLVAVGRQPNTDLLDVAATGVALNDKGRVAVDEFQRTSVEGIYALGDISSDYQLKHVANHEA
    KVVRHNLLNPDAPVASDHRFVPSAVFSSPQIASVGLTERDAVAKGVSYVSVEQPYASIAYGWAMEDTTGFVKLLADPVTG
    QLLGAHVIGPQAPTVVQPLIQAMSFGLDARSMAKGQYWIHPGMPEVVENALLALPLKDQR

    >gi|256380141|ref|YP_003103801.1| dihydrolipoamide dehydrogenase [Actinosynnema mirum DSM 43827]
    MSAHFDVVVLGAGPGGYVAAIRAAQLGLKTAVVEEKYWGGVCLNVGCIPSKALLRNAELAHLFTHEQKTFGIQVDGTVTF
    DYGAAFQRSRKVADGRVKGVHFLMKKNGITEYNGRGTFTDANTIEVNGESITFSHAIIAAGASTRLLPGTELSERVVTYE
    EQILTEDLPESIVIAGAGAIGVEFGYVLHNYGVKVTIVEFLDRMVPLEDVEVSTELAKRYKRMGVDVRTGTRVESIDDSG
    AKVRVTVSKDGKEEVLEADKVLQAIGFQPRVEGYGLESTGVALTERGAIAVDERGRTNVPHIYAIGDVTAKLMLAHAAES
    MGIIAAETIAGAETMELDFPMIPRATFCQPQIASFGWTEAQAREKGFDVQVAKFPFTANGKAHGIGDYSGFVKLISDGEH
    GELLGAHMIGPDVTELLPELTLAQQWDLTVHEVARNVHAHPTLSEAVKEAVHGLAGHMINF

    >gi|256380235|ref|YP_003103895.1| Glutathione peroxidase [Actinosynnema mirum DSM 43827]
    MSIHDIAVNTLTGEPSSLGSLRGKALLVVNVASKCGLTPQYSALERLHAKYAPQGFSVVGFPCNQFGGQEPGTAEEIATF
    CSATYGVTFPMFEKVEVNGANRHPVYEALVESADADGAAGDVQWNFEKFLLSPDGEVLARFRPRTEPEDEAVVRAVEAAL
    PNA

    >gi|256380391|ref|YP_003104051.1| pyridine nucleotide-disulphide oxidoreductase dimerization region [Actinosynnema mirum DSM 43827]
    MTRIVIMGGGPAGYEAALVAAQHGADVTVIEREGLGGACVLYDCVPSKAFIASAASRSAFRSAGELGIRTDDTEAAVELP
    VVHGRVKGLALAQSADVRARLQREGVRIIIGDAEFRDDERGLAQHRVLARTEDGAEEVLEADVVLIATGATPRVLPGAEP
    DGERVLNWRQLYDLPELPEHLAVIGSGVTGVEFASAYTELGVKVTMVSSRDRVLPHEDADAAAVLEDVFAERGTAVVKHA
    RADRVENTGDGVRIHLADGRVVEASHALMTVGSVPNTEGLGLDRIGVELGKGGYIPVDRVSRTTVPGVYAAGDCTGVLLL
    ASVAAMQGRIAMWHALGEGVSPIKLKTVAANVFTNPEIATVGISQQAIDSGEVPARTVMLPLATNPRAKMEGLRRGFVKL
    FCRPATGVVIGGVVVGPTASELILPIALAVQNQLTVEDLATTFSVYPSLTGSITEAGRQLMRHDDLD

    >gi|256380536|ref|YP_003104196.1| thioredoxin domain protein [Actinosynnema mirum DSM 43827]
    MRELTDGTFGAGIAEGLHLVEFGARWCPPCRVVEPVLEELDRELPGLVVSRVDVDASPAVARDARIMSAPTLNLYRDGEL
    VAQSVGARPKSRLVTWLEPHL

    >gi|256380700|ref|YP_003104360.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Actinosynnema mirum DSM 43827]
    MSKKTWWRPATALLALVLASGCATGDDAVAVGGEFQFVAPGGQVRIRYDGPDRKPISGLSGPSLMEDGKTISLDDYEGKV
    VVVNVWGAW
    CPPCRTEAPEMQKVQDEAGPKGVQVLGLDVRETSINAGRDFKSNRGLTYPSIYDDSGRTLLAFKGYPPNAV
    PSTIVLDKQHRVAAVFLESLIASDLLPLVEELAAE

    >gi|256380717|ref|YP_003104377.1| glutaredoxin 2 [Actinosynnema mirum DSM 43827]
    MSHHVTLVTRVDCHSCEQAKADLERICGELGVPWDAVDVDSDRELRAEYGDRVPVILVDGEEHGYWEVEEDRLRAALA

    >gi|256380779|ref|YP_003104439.1| Heavy metal transport/detoxification protein [Actinosynnema mirum DSM 43827]
    MDMAVATYTVTGMTCGHCVSSVTEELTGISGVTDVSVVLESGAVTVTSDRELGLDEVKAAVTEAGYELVG

    >gi|256380780|ref|YP_003104440.1| heavy metal translocating P-type ATPase [Actinosynnema mirum DSM 43827]
    MTTAETGTSRVELAITGMTCASCANRIERKLNKLDGVTASVNYATEKASVEYPDGTDVADLVSTVEAAGYGAQAPQQDRA
    PEPEEDDHAGDLRLRVRLAALLGVPVIVLSMVPAWQFPAWQWLSFALATTVVWVCGWPFHRAAAVNLRHGASTMDTLVSM
    GVTVSYLWSAYALVLGGAGELGMTHGFSLVPRPSSTGDVYLEVAVGVTLFLLLGRWLEARSKRRAGAALRALLALGAKDV
    AVLRDGREVRVPVSELRVGDRFAVRPGERIATDGVVAEGASAVDRSMVTGESAPEEVGVGDRVVGGSVNAGGLLVVEATG
    VGEDTQLARMAALVEQAQSGKAEVQRLADRVSAVFVPVVLGIALVTLVGWLLSGAPVQFAMTATVAVLVIACPCALGLAT
    PTALLVGTGRGAQLGILVKGPEVLESTRRVDTVVLDKTGTVTTGRPELVDVVPAPGVERAELLRVAGAAEHGSEHPIAAA
    VVRGAGAEVGELPPVTGFANEVGVGVSAVLEGRRVEVGRLTSARLPEELVAAGRELEGRGRTVVAVTANGLPLGLLGVTD
    AVKPTSAEAVRGLRDLGLRPVLLTGDNEVVARAVAAEVGVDEVIAGVLPSGKVDAVRRLQEQGRVVAMIGDGVNDAPALA
    AADLGLAMGTGADAAIEAGDLTLVRGDLRVAVDAIRLSRRTLRTIKGNLFWAFAYNVAGLPIAALGLLNPMLAGAVMAFS
    SLFVVSNSLRLRGFRSTAG

    >gi|256380808|ref|YP_003104468.1| hypothetical protein Amir_6826 [Actinosynnema mirum DSM 43827]
    MTGGLLGLLSALVVVAAVAVALRGRGRVRPGSRRGLPAEVRALLDPDAEVTLVQVTTRFCAGCRRSRQVLGALVERTGGL
    RLAELDVTERPALAADLGVLGTPTTIAYDRRGAELLRVTGVPDAEELSGALTGRARPSDG

    >gi|256380810|ref|YP_003104470.1| Rhodanese domain protein [Actinosynnema mirum DSM 43827]
    MSRADVLVSAAWAEENLAAPGVVFVEVDEDTTAYEGGHLPGAVRIDWRTELQDPVRRDFVDRAGFEKLLSAKGIANSDTV
    ILYGGNNNWFAAYAYWYFKLYGHEAVKLVDGGRKKWELDGRPLDKEVVEREATTYQAQEQDLSIRAFRDEVVEAIGAKNL
    VDVRSPDEFSGKLLAPAHLPQEQAQRGGHIPTAINVPWSKTANEDGTFKSDEELTALYADAGLDGSRSTIAY
    CRIGERSS
    HSWFALHELLGHSDVKNYDGSWTEYGSLIGVPVELGPGKEA

    >gi|256380948|ref|YP_003104608.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Actinosynnema mirum DSM 43827]
    MFTSPVTTARRRARVRAPELVGRGWLNTGDQDITLAQLRGKVVLLDFWTFCCINCLHVLDELRPLEAEFADVLVTIGVHS
    PKFVHEADPDALVAAVERYEVHHPVLDDPELTTWQNYAVKAWPTLVVVDPEGYVVHVAAGEGHVDALRQVITELIAEHEA
    KGTLHRGDGPYVAPPPPDTALRFPAKAVLTPAGTLLVSDSAHHSLVELAADGETVLRRVGTGERGRADGLEPTFSEPAGI
    ALLPPEVAATTGYHAVVADTVNHLLRGLNLDTGEVTTVAGTGEQWRDGATDGPADEIPLTSPWDVVWWEPANAVAIALAG
    NHTLGLFDPVAGRLERLAGTTVEGLNDGPADQAFFAQTSGLASDGERLWLVDSETSALRWLDPDRTVHTAVGKGLFDFGH
    RDGPADQALLQHPLGVTALPDGSVAIADTYNGAVRRYDPATGEVSTIATDVAEPSDAVLVDGELVVVASAAHRLERPVAP
    GVRITGDAHRVRRPPTEIGVGELELAVVFTPPTGQKLDDRYGPSTRLEITSSPPGLLVGGAGVGTDLVRGLRVAEGFTEG
    VLHVVAQAASCTDDPAVEHPVCKLTRQDWGVPVRITPDGPSRLPLMMGGLDG

    >gi|256381062|ref|YP_003104722.1| thioredoxin reductase [Actinosynnema mirum DSM 43827]
    MSDVRNLIIVGSGPAGYTAAVYAARAQLEPLVFEGSQYGGALMTTTEVENFPGFRDGIMGPDLMEQMREQAKRFGAELRA
    EDVDAVELEGDVKYVTANGTRYAAKAVVLAMGAAARYLNVPGEQELLGRGVSA
    CATCDGFFFRDQDIAVLGGGDSAMEEA
    TFLTRFARSVTIIHRREDFRASRIMLERARANEKIKWLLNSEVTEVVGTGGAVSGLKIRDTRTGETAEHPFTGFFLAIGH
    DPRSALVRGQVDVDDEGYVKVQPHSTYTNVDGVFAAGDLVDHTYRQAITAAGSGCSAAIDAERWLAEHGAGEAAVTAEHV
    GGGYGEPATTG

    >gi|256381063|ref|YP_003104723.1| thioredoxin [Actinosynnema mirum DSM 43827]
    MAGSTVVVSDKTFADDVLTSEKPVLVDFWATWCGPCKMVAPVLEEIAAEHADKITVAKLDIDANPGIARDYQIMSVPTLI
    LFQGGRAVKQIVGAKPKAALLNDLADVL