Chlamydophila pneumoniae CWL029 uid57811

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|15618152|ref|NP_224437.1| disulfide bond chaperone [Chlamydophila pneumoniae CWL029]
    MNKKILVLCTAMFFIVCFGFLIHKKHTILPPKAHIPTNAKHFPTIGNPYAPINITVFEEPSCSACAEFTTEVFPLLKKHY
    IDTGEISFTLIPVCFIRGSKPAAQALLCIYHHDPRQADIDAYMEYFHRILTYPKEEGSHWATPEVLTKLAEGLKINSGRS
    VNPKGLEQCIASGQYNEQIKKNNLYGSQVLGGQLATPTAVVGDYLIEDPTFHEIERAIQHIRQLQAVEGDHDD

    >gi|15618234|ref|NP_224519.1| thioredoxin reductase [Chlamydophila pneumoniae CWL029]
    MIHSRLIIIGSGPSGYTAAIYASRALLHPLLFEGFFSGISGGQLMTTTEVENFPGFPEGILGPKLMNNMKEQAVRFGTKT
    LAQDIISVDFSVRPFILKSKEETYSCDACIIATGASAKRLEIPGAGNDEFWQKGVTA
    CAVCDGASPIFKNKDLYVIGGGD
    SALEEALYLTRYGSHVYVVHRRDKLRASKAMEARAQNNEKITFLWNSEIVKISGDSIVRSVDIKNVQTQEITTREAAGVF
    FAIGHKPNTDFLGGQLTLDESGYIVTEKGTSKTSVPGVFAAGDVQDKYYRQAVTSAGSGCIAALDAERFLG

    >gi|15618344|ref|NP_224629.1| Na(+)-translocating NADH-quinone reductase subunit D [Chlamydophila pneumoniae CWL029]
    MTSKKSYKSYFFDPLWSNNQILIAILGICSALAVTTTVQTAITMGIAVSIVTGCSSFFVSLLRKFTPDSVRMITQLIIIS
    LFVIVIDQFLKAFFFDISKTLSVFVGLIITN
    CIVMGRSESLARHVTPIPAFLDGFASGLGYGWVLLVIGVIRELFGFGTL
    MGFRIIPQFVYASETHPDGYQNLSLMVLAPSAFFLLGIMIWLVNIRDSKKRKR

    >gi|15618345|ref|NP_224630.1| Na(+)-translocating NADH-quinone reductase subunit E [Chlamydophila pneumoniae CWL029]
    MWLGAYTWLNVFGILLQAAFIQNILLANFLGMCSYLACSTRVSTANGLGMSVALVLTVTGSINWFVHAFITGPKALTWIS
    PSLASVNLGFLELIIFIVVIAAFTQILELLLEKVSRNLYLSLGIFLPLIAVN
    CAILGGVLFGITRSYPFIPMMIFSLGAG
    CGWWLAIVILATIKEKLAYSDIPKNLQGMGISFITTGLIAMAFMSLTGIDISKPSAKIQRAPLETEVVENTTNPLKESSS
    KHQPSISKARTQRRSL

    >gi|15618506|ref|NP_224792.1| methyltransferase [Chlamydophila pneumoniae CWL029]
    MADDTLIPKLMKNSLSQACSEGLLIAKYPPLQVIVHFDNNLVVKTHLSVAPVFSCLFLGPAAHKAMQEIVLWCSRYANKE
    HPPFSSHFAKDLIPSQYLEILNCVAEIPFGEQQTYAEIAKKTDTHPRTVGAACKQNPFLLFFP
    CHRVVGSHGERNYVLGP
    VIHEILLKFENSY

    >gi|15618569|ref|NP_224855.1| thioredoxin [Chlamydophila pneumoniae CWL029]
    MVKIISSENFDSFIASGLVLVDFFAEWCGPCRMLTPILENLAAELPHVTIGKINIDENSKPAETYEVSSIPTLILFKDGN
    EVARVVGLKDKEFLTNLINKHA

    >gi|15618644|ref|NP_224930.1| hypothetical protein CPn0734 [Chlamydophila pneumoniae CWL029]
    MEKKYYALAYYYITRVDNPHEEIALHKKFLEDLDVSCRIYISEQGINGQFSGYEPHAELYMQWLKERPNFSKIKFKIHHI
    KENIFPRITVKYRKELAALGCEVDLSKQAKHISPQEWHEKLQENRCLILDVRNNYEWKIGHFDNATLPDIQTFREFPEYA
    EKLAQECDPETTPVMMY
    CTGGIRCELYSPVLLEKGFKEVYQLDGGVIAYGQQVGTGKWLGKLFVFDDRLAIPIDESDPDV
    APIAECCHCQTPSDAYYNCANTDCNALFLCCDECIHQHQGCCGEECSQSPRVRKFDSSRGNKPFRRAHLCEISENSESAS
    CCLI

    >gi|15618687|ref|NP_224973.1| Thio-specific antioxidant (TSA) peroxidase [Chlamydophila pneumoniae CWL029]
    MTLSLVGKEAPDFVAQAVVNGETCTVSLKDYLGKYVVLFFYPKDFTYVCPTELHAFQDALGEFHTRGAEVIGCSVDDIAT
    HQQWLATKKKQGGIEGITYPLLSDEDKVISRSYHVLKPEEELSFRGVFLIDKGGIIRHLVVNDLPLGRSIEEELRTLDAL
    IFFETNGLVCPANWHEGERAMAPNEEGLQNYFGTID

    >gi|15618695|ref|NP_224981.1| Thio:disulfide interchange protein [Chlamydophila pneumoniae CWL029]
    MIAPFFSFPALSGSFSSIQAEEITQQVNHPGAELLSEGSYIPGLQTFRLGIKITASKGSHIYWKNPGEIGSPLKISWQLP
    KGFVVEEEHWPTPKVFEEEGTTFFGYEDSALIVADVRAPEGYTPGQEVELRAQVEWLACGDSCLPGNVDLKLTLPYEEKE
    PSLYPDTHAEFTKTLHAQPRVLENDHSVQVAQGKGNEIILNISKKINATKAWFVSEKADKLFAYAETSYSGGTGTAWRLK
    VKNLSGVQKNEKLHGILLLADHTGRPVESLTIHSEVLGQTGSAVAGLSQYITILIMAFLGGVLLNIMPCVLPLVTLKVYG
    LIKSAGEHRSSVIANGLWFTLGVVGCFWGLAGVAFILKVLGHNIGWGFQLQEPMFVATLIIVFFLFALSSLGLFEMGTMF
    ANLGGKLQSSEMKSSNNKAVGAFFNGILATLVTTPCTGPFLGSVLGLVMSLSFLQQLLIFTAIGLGMASPYLVFSVFPKM
    LSVLPKPGGWMSTFKQLTGFMLLVTVTWLVWIFGSETSTTSVVVLLGGLWLAGLGAWILGRWGTPVSPKKQRVCASLLFF
    AFLGGAISVSGLASHYFAEPQQTVSVNEDSLWQPFSLEKLAQLRAQGRPVFVNFTAKW
    CLTCQMNKPVLYGDAVQKMFET
    HGIVTLEADWTRKDPGITEELARLGRASVPSYVYYPGDNSAPVVLPEKITQNLLEDVVSRFVR

    >gi|15618742|ref|NP_225028.1| dihydrolipoamide dehydrogenase [Chlamydophila pneumoniae CWL029]
    MTQEFDCVVIGAGPSGYVAAITAAQSKLRTALIEEDQAGGTCLNRGCIPSKALIAGANVVSHIKHAEQFGIHVDGYTIDY
    PAMAKRKNTVVQGIRQGLEGLIRSNKITVLKGTGSLVSSTEVKVIGQDTTIIKANHIILATGSEPRPFPGVPFSSRILSS
    TGILELEVLPKKLAIIGGGVIGCEFASLFHTLGVEITVIEALDHILAVNNKEVSQTVTNKFTKQGIRILTKASISAIEES
    QNQVRITVNDQVEEFDYVLVAIGRQFNTASIGLDNAGVIRDDRGVIPVDETMRTNVPNIYAIGDITGKWLLAHVASHQGV
    IAAKNISGHHEVMDYSAIPSVIFTHPEIAMVGLSLQEAEQQNLPAKLTKFPFKAIGKAVALGASDGFAAIVSHEITQQIL
    GAYVIGPHASSLIGEMTLAIRNELTLPCIYETVHAHPTLSEVWAEGALLATNHPLHFPPKS

    >gi|15618835|ref|NP_225121.1| thioredoxin disulfide isomerase [Chlamydophila pneumoniae CWL029]
    MKFWLQGCAFVGCLLLTLPCCAARRRASGENLQQTRPIAAANLQWESYAEALEHSKQDHKPICLFFTGSDWCMWCIKMQD
    QILQSSEFKHFAGVHLHMVEVDFPQKNHQPEEQRQKNQELKAQYKVTGFPELVFIDAEGKQLARMGFEPGGGAAYVSKVK
    SALKLR