Chlamydophila pneumoniae AR39 uid57809

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|16752307|ref|NP_444564.1| hypothetical protein CP0012 [Chlamydophila pneumoniae AR39]
    MEKKYYALAYYYITRVDNPHEEIALHKKFLEDLDVSCRIYISEQGINGQFSGYEPHAELYMQWLKERPNFSKIKFKIHHI
    KENIFPRITVKYRKELAALGCEVDLSKQAKHISPQEWHEKLQENRCLILDVRNNYEWKIGHFDNATLPDIQTFREFPEYA
    EKLAQECDPETTPVMMY
    CTGGIRCELYSPVLLEKGFKEVYQLDGGVIAYGQQVGTGKWLGKLFVFDDRLAIPIDESDPDV
    APIAECCHCQTPSDAYYNCANTDCNALFLCCDECIHQHQGCCGEECSQSPRVRKFDSSRGNKPFRRAHLCEISENSESAS
    CCLI

    >gi|16752381|ref|NP_444640.1| thioredoxin [Chlamydophila pneumoniae AR39]
    MVKIISSENFDSFIASGLVLVDFFAEWCGPCRMLTPILENLAAELPHVTIGKINIDENSKPAETYEVSSIPTLILFKDGN
    EVARVVGLKDKEFLTNLINKHA

    >gi|16752444|ref|NP_444704.1| DNA methyltransferase [Chlamydophila pneumoniae AR39]
    MADDTLIPKLMKNSLSQACSEGLLIAKYPPLQVIVHFDNNLVVKTHLSVAPVFSCLFLGPAAHKAMQEIVLWCSRYANKE
    HPPFSSHFAKDLIPSQYLEILNCVAEIPFGEQQTYAEIAKKTDTHPRTVGAACKQNPFLLFFP
    CHRVVGSHGERNYVLGP
    VIHEILLKFENSY

    >gi|16752609|ref|NP_444872.1| Na(+)-translocating NADH-quinone reductase subunit E [Chlamydophila pneumoniae AR39]
    MWLGAYTWLNVFGILLQAAFIQNILLANFLGMCSYLACSTRVSTANGLGMSVALVLTVTGSINWFVHAFITGPKALTWIS
    PSLASVNLGFLELIIFIVVIAAFTQILELLLEKVSRNLYLSLGIFLPLIAVN
    CAILGGVLFGITRSYPFIPMMIFSLGAG
    CGWWLAIVILATIKEKLAYSDIPKNLQGMGISFITTGLIAMAFMSLTGIDISKPSAKIQRAPLETEVVENTTNPLKESSS
    KHQPSISKARTQRRSL

    >gi|16752610|ref|NP_444873.1| Na(+)-translocating NADH-quinone reductase subunit D [Chlamydophila pneumoniae AR39]
    MTSKKSYKSYFFDPLWSNNQILIAILGICSALAVTTTVQTAITMGIAVSIVTGCSSFFVSLLRKFTPDSVRMITQLIIIS
    LFVIVIDQFLKAFFFDISKTLSVFVGLIITN
    CIVMGRSESLARHVTPIPAFLDGFASGLGYGWVLLVIGVIRELFGFGTL
    MGFRIIPQFVYASETHPDGYQNLSLMVLAPSAFFLLGIMIWLVNIRDSKKRKR

    >gi|16752725|ref|NP_444992.1| thioredoxin reductase [Chlamydophila pneumoniae AR39]
    MIHSRLIIIGSGPSGYTAAIYASRALLHPLLFEGFFSGISGGQLMTTTEVENFPGFPEGILGPKLMNNMKEQAVRFGTKT
    LAQDIISVDFSVRPFILKSKEETYSCDACIIATGASAKRLEIPGAGNDEFWQKGVTA
    CAVCDGASPIFKNKDLYVIGGGD
    SALEEALYLTRYGSHVYVVHRRDKLRASKAMEARAQNNEKITFLWNSEIVKISGDSIVRSVDIKNVQTQEITTREAAGVF
    FAIGHKPNTDFLGGQLTLDESGYIVTEKGTSKTSVPGVFAAGDVQDKYYRQAVTSAGSGCIAALDAERFLG

    >gi|16752811|ref|NP_445080.1| hypothetical protein CP0536 [Chlamydophila pneumoniae AR39]
    MNKKILVLCTAMFFIVCFGFLIHKKHTILPPKAHIPTNAKHFPTIGNPYAPINITVFEEPSCSACAEFTTEVFPLLKKHY
    IDTGEISFTLIPVCFIRGSKPAAQALLCIYHHDPRQADIDAYMEYFHRILTYPKEEGSHWATPEVLTKLAEGLKINSGRS
    VNPKGLEQCIASGQYNEQIKKNNLYGSQVLGGQLATPTAVVGDYLIEDPTFHEIERAIQHIRQLQAVEGDHDD

    >gi|16752110|ref|NP_445477.1| hypothetical protein CP0940 [Chlamydophila pneumoniae AR39]
    MKFWLQGCAFVGCLLLTLPCCAARRRASGENLQQTRPIAAANLQWESYAEALEHSKQDHKPICLFFTGSDWCMWCIKMQD
    QILQSSEFKHFAGVHLHMVEVDFPQKNHQPEEQRQKNQELKAQYKVTGFPELVFIDAEGKQLARMGFEPGGGAAYVSKVK
    SALKLR

    >gi|16752206|ref|NP_445574.1| dihydrolipoamide dehydrogenase [Chlamydophila pneumoniae AR39]
    MTQEFDCVVIGAGPSGYVAAITAAQSKLRTALIEEDQAGGTCLNRGCIPSKALIAGANVVSHIKHAEQFGIHVDGYTIDY
    PAMAKRKNTVVQGIRQGLEGLIRSNKITVLKGTGSLVSSTEVKVIGQDTTIIKANHIILATGSEPRPFPGVPFSSRILSS
    TGILELEVLPKKLAIIGGGVIGCEFASLFHTLGVEITVIEALDHILAVNNKEVSQTVTNKFTKQGIRILTKASISAIEES
    QNQVRITVNDQVEEFDYVLVAIGRQFNTASIGLDNAGVIRDDRGVIPVDETMRTNVPNIYAIGDITGKWLLAHVASHQGV
    IAAKNISGHHEVMDYSAIPSVIFTHPEIAMVGLSLQEAEQQNLPAKLTKFPFKAIGKAVALGASDGFAAIVSHEITQQIL
    GAYVIGPHASSLIGEMTLAIRNELTLPCIYETVHAHPTLSEVWAEGALLATNHPLHFPPKS

    >gi|16752255|ref|NP_445623.1| thiol:disulfide interchange protein DsbD [Chlamydophila pneumoniae AR39]
    MNKFKTYLQTALIAPFFSFPALSGSFSSIQAEEITQQVNHPGAELLSEGSYIPGLQTFRLGIKITASKGSHIYWKNPGEI
    GSPLKISWQLPKGFVVEEEHWPTPKVFEEEGTTFFGYEDSALIVADVRAPEGYTPGQEVELRAQVEWLACGDSCLPGNVD
    LKLTLPYEEKEPSLYPDTHAEFTKTLHAQPRVLENDHSVQVAQGKGNEIILNISKKINATKAWFVSEKADKLFAYAETSY
    SGGTGTAWRLKVKNLSGVQKNEKLHGILLLADHTGRPVESLTIHSEVLGQTGSAVAGLSQYITILIMAFLGGVLLNIMPC
    VLPLVTLKVYGLIKSAGEHRSSVIANGLWFTLGVVGCFWGLAGVAFILKVLGHNIGWGFQLQEPMFVATLIIVFFLFALS
    SLGLFEMGTMFANLGGKLQSSEMKSSNNKAVGAFFNGILATLVTTPCTGPFLGSVLGLVMSLSFLQQLLIFTAIGLGMAS
    PYLVFSVFPKMLSVLPKPGGWMSTFKQLTGFMLLVTVTWLVWIFGSETSTTSVVVLLGGLWLAGLGAWILGRWGTPVSPK
    KQRVCASLLFFAFLGGAISVSGLASHYFAEPQQTVSVNEDSLWQPFSLEKLAQLRAQGRPVFVNFTAKW
    CLTCQMNKPVL
    YGDAVQKMFETHGIVTLEADWTRKDPGITEELARLGRASVPSYVYYPGDNSAPVVLPEKITQNLLEDVVSRFVR

    >gi|16752263|ref|NP_445631.1| anti-oxidant AhpCTSA family protein [Chlamydophila pneumoniae AR39]
    MRNNKRVEEEVFMTLSLVGKEAPDFVAQAVVNGETCTVSLKDYLGKYVVLFFYPKDFTYVCPTELHAFQDALGEFHTRGA
    EVIGCSVDDIATHQQWLATKKKQGGIEGITYPLLSDEDKVISRSYHVLKPEEELSFRGVFLIDKGGIIRHLVVNDLPLGR
    SIEEELRTLDALIFFETNGLVCPANWHEGERAMAPNEEGLQNYFGTID