Chlamydophila felis Fe C 56 uid57971

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|89897841|ref|YP_514951.1| thio-specific antioxidant peroxidase [Chlamydophila felis Fe/C-56]
    MHNHKNRVVMGSLFVGKTAPDFSAQAVVDGEVKNISLKDYRGKYVILFFYPKDFTYVCPTELHAFQHSLEEFESRGAQIL
    GCSVDDLDTHKRWLETDKKAGGVKGITYPLISDTTQELSKLYSVLDLQSGLSFRGSFLIDKDGIIRHMVINDLPLGRSID
    EELRVLDALIFFENHGLVCPANWQQGQKAMAPNEEGLKEYFGTID

    >gi|89897849|ref|YP_514959.1| thioredoxin [Chlamydophila felis Fe/C-56]
    MYNYLPDLEIIGVVLNKIKKHFQTILVAFLFSLPAFTECGQKLHAAEPVVEQVAPGATLISEGTHIPKGEVFRVGVRVSA
    LKGSHIYWKNPGEEGSPLRIHWNLPKGFVVEEEHWPSPKVFEEDGTTFFGYDDNALIVADIRAPKNGDDRESVVLKVHVE
    WLACGESCVPGNADLELALPYRDGAATLYPEKSAEFAQTLQAQPRLLKDDRAITLGRSQEGEIILNITGQQNRAEKAWFI
    SEKADKIFAYSEEAIKEASGTAWKLKVKTLAGVQKNQELQGVLLLTDSAGHEVESFAVRGQINDSGESASDLWNYITIVA
    MAFLGGLLLNIMPCVLPLVTLKVYGLIKSAGEHRSSVIINGLCFTLGVVGCFWGLAGVAFLLKMLGHNIGWGFQLQEPMF
    VATLIIVFFLFALSSLGLFETGAMFANLGAKLRPTGSGDSRNKAVGAVFNGVLATLVTTPCTGPFLGSILGLVMSLSFIK
    QLTIFTSIGLGMASPYLVFSVFPKMLSVLPKPGSWMSTFKQLTGFMLLGTVTWLAWIFGSETSTTALIILLAGLWLAGIG
    AWILGKWGSPVSPKKQRMVVSALFFGCITGALSLSFVASRHFSGEGETVVIQENNAWQPFSATKLAQLRKEGHAVFVNFT
    AKW
    CLTCQMNKPVLYASAVQEMFKEHGVVTLEADWTRKDPGITEELARLGRASVPSYVYYPADQSDPIVLPEKITQSVLE
    SMVFSKN

    >gi|89897888|ref|YP_514998.1| dihydrolipoamide dehydrogenase [Chlamydophila felis Fe/C-56]
    MSTDFDCVVIGAGPGGYVAAITSAQQGLKTALIEEQQAGGTCLNRGCIPSKALLVGSGIVSQIKHAKQFGINVDGYSVDY
    PAMVQRKNTVVNGIRQGLEGLIRSNKITVFNGQGSLISSTEVRVKGQDTTVIKAKQIIIATGSESRPFPGAPFSSRIL
    CS
    TGILNLSELPKKLVIIGGGVIGCEFASLFNTLGVEITIIEVADQILSMNNSDISKTMLDKFSHQGIRIVTKASIGQLEDL
    GDRVRISVNEQIEEYDYALVAIGRQFNTTDIGLDNAGVIRNERGIIPVDETMRTNVTNIFAIGDITGKWLLAHVASHQGI
    IAGRNAAGHNEVMDYSAVPAVIFTFPEVATVGLSLEAAQQQGIPAKLTKFPFKAIGKAVAMAEADGFAAIISHETTQQIL
    GAYVVGPHAASLIAEMTLAVRNELTLPCIYETIHAHPTLAEVWAEGALLATNHPLHLPPLRL

    >gi|89897980|ref|YP_515090.1| thioredoxin/thiol-disulfide isomerase [Chlamydophila felis Fe/C-56]
    MKRWLQGSLIALCLLLTLPCCAAKKRSHYQKDFGKLKIQEVKASGVLWESYANAVEQSKKDKKYIGLFFTGSDWCIWCIK
    MQDQILNTPEFQQYAKDNLHMVELDFPQSNSQPEDVKQQNQALKSKYGVNGFPTLVFIDANGNEKVRMGFEYGGGDNYVK
    KIQAALHKK

    >gi|89898221|ref|YP_515331.1| disulfide bond chaperone [Chlamydophila felis Fe/C-56]
    MIYKKQTLLPPKAHIPTNAKHFPTLGNPYAPINITVFEEPSCSACAEFSSEVFPLLKEHYIDTGEVSFTLIPVCFIRGSM
    PAAQALLCVYHHDPRQPDIEAYIEYFHRLLNYPKEEGKRWATPEVLTKLTENLKTHSGRTINPKGLIQCVDSQQYEEQIK
    KNNIYGSRVLGGQLATPTAVVGDYLIEDPTFDELERVIKQIRHLQAAEENDD

    >gi|89898346|ref|YP_515456.1| thioredoxin reductase [Chlamydophila felis Fe/C-56]
    MTHTKVIIIGSGPAGYTAAIYASRALLSPILFEGFFSGISGGQLMTTTDVENFPGFPEGVLGQKLMDNMKAQSARFGTQI
    LPKDVTSVDFSARPFVVMSNEEKYTCDTCIIATGASAKRLEIPGAGDNEFWQKGVTA
    CAVCDGASPIFKNKDLYVIGGGD
    SALEEAMFLTRYGKRVYVVHRRDALRASKVMIKKAEANEKIFFLWNSEVIKISGDSVVRSVDILNNVSNEISTHDAAGVF
    FAIGHKPNTDFLAGQLALDEHGYIITEKGTCKTFIPGVFAAGDVQDKYYRQAITAAGSGCMAALEAERFLD

    >gi|89898451|ref|YP_515561.1| Na(+)-translocating NADH-quinone reductase subunit D [Chlamydophila felis Fe/C-56]
    MADNKPYKSYFLDPLWNNNQPLIAILGICSALAVTTTVKTAITMGLAVSFVTGCSSFFVSLLRKITPDSVRMITQLIIIS
    LFVIVIDQFLKAFFFNISKTLSVFVGLIITN
    CIVMGRAESLARNVPPIPAFLDGLASGLGYGWVLVFVSIIREFFGFGTL
    LGLQLIPKCFYASEAHPDGYENFGLMVLAPSAFFLLGIMIWVVNILRSKKAKR

    >gi|89898452|ref|YP_515562.1| Na(+)-translocating NADH-quinone reductase subunit E [Chlamydophila felis Fe/C-56]
    MWLGEYTWLNVFGIFLQATFIQNILLSNFLGMCSYLACSGRVSTANGLGMSVALVLTITGSINWAVHAFITGPKALTWLS
    PALANVNLNFLELIIFIVVIAAFTQILELLLEKISRNLYLSLGIFLPLIAVN
    CAILGGVLFGITRNYPFIPMMIFSLGAG
    CGWWLAIVLFATIKEKLAYSDIPKNLQGMGISFITTGLIAMAFMSLTGIDISKPSVTTSGSDTEIYDISSSEIKDFKSET
    KMNTAPSQHATKVKAINRKKGKA

    >gi|89898669|ref|YP_515779.1| methylated-DNA--protein-cysteine S-methyltransferase [Chlamydophila felis Fe/C-56]
    MSENLYLVSDDSKFSLSQACSQGLQIAKYPPLQVIVHFQNNTVIKTQLSIAPVFSCLFLGPGSHKAMEEIVLLCAKYSQK
    IAIPQSSYINTSVLSGQQETILNSVAQIPFGQTRTYKDIARETDTHPRTVGSACKNNPFLLFFP
    CHRVIGSNGERHYCAG
    KQIQNILLNFEESLS

    >gi|89898731|ref|YP_515841.1| thioredoxin [Chlamydophila felis Fe/C-56]
    MVKVVSAENFDSFIASGLVLIDFFAEWCGPCKMLSPVLDSLATEMPAVLIGKVNIDDHPAPAEKYGVSSIPTLILFKDGK
    EVDRVVGLKDKDSLIKLINQYA

    >gi|89898803|ref|YP_515913.1| hypothetical protein CF0996 [Chlamydophila felis Fe/C-56]
    MKKNYYALAYYHFTRVDNPQEEIALHKELFKKLDVSCRIYISEQGINGQFSGYQPDAEYYMNWLKQRPGFSNVKFKIHHI
    EENIFPRATVKYRKELVALGCDVDLSNQGKHISPKEWHEKLEENRCLVLDVRNNYEWKIGHFENAVLPDIQTFREFPEYA
    EQLSKEHDPETTPVMMY
    CTGGIRCELYSSLLLEKGFKEVYQLDGGVIAYGQAMGTGKWRGKLFVFDDRLAVPIDEADTDV
    SPIAQCSHCEASCDTYYNCANTDCNNLFICCEECIHSTKGCCSQECSQAPRIRSFSTSRGNKPFRRMHLCEISEEQEKPL
    SCCLR