Chlamydophila caviae GPIC uid57783

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|29839779|ref|NP_828885.1| hypothetical protein CCA00010 [Chlamydophila caviae GPIC]
    MKKNYYALAYYYLTRVDNPQLEIALHKELFKDLDVSCRIYISEQGINGQFSGYQPDAEHYMNWLRQRPGFSNVKFKIHHI
    EENIFPRVTVKYRKELVALGCDVDLTTQGKHISPKEWHEKLKENRCLVLDVRNNYEWKIGHFENAVLPDIQTFREFPEYA
    ERLSKEHDPATTPVMMY
    CTGGIRCELYSSLLLEKGFKEVYQLDGGVIAYGQAVGTGKWRGKLFVFDDRLAVPIDETDTDV
    APIAQCSHCGVGCDTYYNCANTDCNNLFICCEDCIDSTKGCCSQECSQAPRIRAFSPSRGNKPFRRMHLCEQVECEQVEK
    KASSCCCSCSH

    >gi|29839848|ref|NP_828954.1| thioredoxin [Chlamydophila caviae GPIC]
    MVKVVSAENFNSFIATGLVLIDFFAEWCGPCKMLTPVLESLEAEVSSVLIGKVNIDDHPAPAEQYGVSSIPTLILFKDGK
    EVDRVVGLKDKDSLIRLINQHS

    >gi|29839913|ref|NP_829019.1| DNA methyltransferase [Chlamydophila caviae GPIC]
    MSENLYLVSDDSKLSLSQACSQGLQIAKHPPLQVIVHFQNNTVVKTQLSVAPVFCCLFLGPASHKAMEEIVLLCAKYSQK
    LDIPRSSYINTSILSEQQKTILDCVAKIPFGQTRTYGEIARETDTHPRTVGSACKNNPFLLFFP
    CHRVIGSNGERHYCAG
    EQIQNILLNFEGSLS

    >gi|29840126|ref|NP_829232.1| Na(+)-translocating NADH-quinone reductase subunit E [Chlamydophila caviae GPIC]
    MWLGEYTWLNVFGIFLQATFIQNILLSNFLGMCSYLACSARVSTANGLGMSVALVLTVTGSINWVVHTFITGPKALTWIS
    PSLANVNLNFLELIIFIVVIAAFTQILELLLEKVSRNLYLSLGIFLPLIAVN
    CAILGGVLFGITRNYPFIPMMIFSLGAG
    CGWWLAIVLFATIKEKLAYSDIPKNLQGMGISFITTGLIAMAFMSLTGIDISKPSAAAPTSDILETPNASSITTTNLKPV
    KKVRIAQQRAAKEKAINIKRGKTQ

    >gi|29840127|ref|NP_829233.1| Na(+)-translocating NADH-quinone reductase subunit D [Chlamydophila caviae GPIC]
    MAANKSYKSYFLDPLWGNNQPLIAILGICSALAVTTTVNTAITMGLAVSFVTGCSSFFVSLLRKATPDSVRMITQLIIIS
    LFVIVIDQFLKAFFFTISKTLSVFVGLIITN
    CIVMGRAESLARNVPPIPAFLDGLASGLGYGWVLVTVSIVREFFGFGTI
    LGLQLIPKCFYASETHPDGYENFGLMVLAPSAFFLLGIMIWGVNILRSKKAKR

    >gi|29840229|ref|NP_829335.1| thioredoxin reductase [Chlamydophila caviae GPIC]
    MTHTKVIIIGSGPAGYTAAIYASRALLSPILFEGFFSGIAGGQLMTTTEVENFPGFPEGILGQKLMDNMKSQAAHFGTQI
    LPKDVTSVNFTKRPFVIMSNEEKYTCDTCIIATGASAKRLEIPGASDNEFWQKGVTA
    CAVCDGASPIFKNKDLYVIGGGD
    SALEEAMFLTRYGKRVYIVHRRDTLRASKVMIKKAEANEKITFLWNSEIVKISGDTVVRSVDILNNVSKEISSRDAAGVF
    FAIGHKPNTDFLAGQLALDEHGYIITDKGTSKTSVPGVFAAGDVQDKYYRQAITAAGSGCMAALEAERFLD

    >gi|29840346|ref|NP_829452.1| hypothetical protein CCA00588 [Chlamydophila caviae GPIC]
    MNKKILVIVTSAFFLLCFGLMLYKKQQILPPKAHIPTNAKHFPTLGNPYAPINITVFEEPSCAACAEFSTEVFPLLRKKY
    IDTGEVSFTLIPVCFIRGSMPAAQALLCIYHHDPRQVDIEAYIEYFHRLLTYPKEEGKRWATPEVLTKLSENLKTHSGRS
    INPKGLMQCVDSQQYEEQIKKNNIYGSQVLGGQLATPTAVVGDYLIEDPTFDELERVIRQIRHLQATEENDD

    >gi|29840599|ref|NP_829705.1| hypothetical protein CCA00842 [Chlamydophila caviae GPIC]
    MKRWFQGSLIALCLLLTLPCCAAKRRSQHQKDSGKVTVQQVKDSGVQWERYTNAVEQSKKDHKPIGLFFTGSDWCIWCMK
    MKDQILNTVEFADYANEHLHMVELDFPQVNNQPEDVQQQNRALKSKYGVNGLPTLVFIDANGAEKARMGFEYGGGANYVK
    KIQAALKQK

    >gi|29840688|ref|NP_829794.1| dihydrolipoamide dehydrogenase [Chlamydophila caviae GPIC]
    MSTDFDCVVIGAGPGGYVAAITAAQQGLKTALIEEQQAGGTCLNRGCIPSKALLVGAGIVSQIKHAKQFGIHIDGYSVDY
    PTMVQRKNTVINGIRQGLEGLIRSNKITVLNGRGSLISSTEVRVKGQDTTVIKAKHIIIATGSESRPFPGVPFSSRVL
    CS
    TGILNLTELPKKLAIIGGGVIGCEFASLFNTLGVEVTIIEVADQILSVNNADISKTMLDKFSQRGIQVITRASINQLEDL
    GDRVKITVNDQPQEYEYVLVAIGRQFNTTDIGLDNAGVIRDERGVIPVDEMMRTNVANIFAIGDITGKWLLAHVASHQGI
    VAGRNAAGHNEIMDYSAVPAVIFTFPEVAMVGLSLEAAQKQNIPAKLTKFPFKAIGKAVAMAEADGFAAIISHETTQQIL
    GAYVVGPHAASLIAEMTLAVRNELTLPCIYETIHAHPTLAEIWSESALLATNHPLHLPPPRL

    >gi|29840726|ref|NP_829832.1| thiol:disulfide interchange protein DsbD [Chlamydophila caviae GPIC]
    MNKIKKHFQTILVAFLFSLPAFTGYGQKLHAAEPVVEKALPGATLVSEGSHIPKGGIFRLGIKITAPKGSHIYWKNPGEV
    GSPLRINWNLPKGFVVEEEHWPAPKVFEEDGMTFFGYDDNAFIVADIRAPEGGADKEAVELKAHVEWLACGESCVPGNVD
    LVLSLPYRDGVAALHPERSVEFAQTLQSQPRLLKDNQAITLGRSQEGEIILNITGSQHHAKKAWFISEKADKIFAYSEEA
    INETSGTAWKLKIKTLSGVEKNQELQGVLLLTDSAGQEIESFIVHGQISDSGQSSELWNYITIIAMAFLGGLLLNIMPCV
    LPLVTLKVYGLIKSAGEHRSSVILNGLCFTLGVVGCFWGLAGVAFLLKMLGHNIGWGFQLQEPMFVATLIIVFFLFALSS
    LGLFEIGTMFANLGGKLQSTDAGASKSKIVGAVFNGVLATLVTTPCTGPFLGSILGLVMSLSFIKQLMIFTSIGLGMALP
    YLVFSVFPKMLSVLPKPGNWMSTFKQLTGFMLLGTVTWLAWIFGSETSTTALILLLAGLWLAGIGAWILGKWGTPVSPRK
    QRVFASTLFFGFLAGALSLSFIASRYFAEEAETVVVQEGSSWQPFSATKLAQLRKEGQAVFVNFTAKW
    CLTCQMNKTVLH
    AAAIKEMFKEHGVVTLEADWTRKDPGITEELARLGRASVPSYVYYPADQSEPVVLPEKITQAVLEDMVFSKS

    >gi|29840734|ref|NP_829840.1| anti-oxidant AhpCTSA family protein [Chlamydophila caviae GPIC]
    MESLFIGKAAPDFSVQAVVNGEVKNVSLKDYRGKYVILFFYPKDFTYVCPTELHAFQDSLEEFENRGAQIIGCSVDDLDT
    HKRWLNTDKKAGGVKGITYPLVSDTTHELSKLYGVLDSLSGLSFRGSFLIDKEGIIRHLVINDLPLGRSIDEELRVLDAL
    IFYENHGLVCPANWQQGQKAMAPNEEGLKEYFGTID