Chlamydophila abortus S26 3 uid57963

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|62184657|ref|YP_219442.1| hypothetical protein CAB010 [Chlamydophila abortus S26/3]
    MKKNYYALAYYYLTRVDNPQQEIALHKELFKDLDVSCRIYISEQGINGQFSGYQPDAEYYMNWLRQRPGFSNVKFKIHHI
    EENIFPRVTVKYRKELVALGCDVDLSNQGKHISPQEWHEKLEENRCLVLDVRNNYEWKIGHFENAVLPDIRTFREFPDYA
    EQLSKEHDPATTPVMMY
    CTGGIRCELYSSLLLEKGFKEVYQLDGGVIAYGQAVGTGKWRGKLFVFDDRLAVPIDEADTDV
    PPIASCSHCETPCDTYYNCANTDCNNLFICCKECIHSTKGCCSQECSQAPRIRSFAPCRGNKPFRRMHLCEVTKEKEEAA
    SSCCLH

    >gi|62184726|ref|YP_219511.1| putative thioredoxin [Chlamydophila abortus S26/3]
    MVKVVSAENFNSFIASGLVLIDFFAEWCGPCKMLAPVLESLATEVPSVLIGKVNIDDSPAPAEQYGVSSIPTLILFKDGK
    EVDRTVGLKDKDALIKLINQHA

    >gi|62184788|ref|YP_219573.1| putative DNA methyltransferase [Chlamydophila abortus S26/3]
    MSENLYLVSDDSKFSLSQACSQGLQIAKYPPLQVIVHFQNNAVVKTELSVSPVFSCLFLGPGSHKAMEEIVLLCAKYSQK
    IDMPRSSYINTSILKKQQEMILNCVATIPFGQTHTYGDIAQATDTHPRTVGAVCKQNPFLLFFP
    CHRVIGSHGERHYCAG
    KQIQDILLNFEGSIS

    >gi|62184984|ref|YP_219769.1| Na(+)-translocating NADH-quinone reductase subunit E [Chlamydophila abortus S26/3]
    MWLGEYTWLNVFGIFLQATFIQNILLSNFLGMCSYLACSGRVSTANGLGMSVALVLTVTGSINWFVHAFITGPKALTWLS
    PALANVNLNFLELIIFIVVIAAFTQILELFLEKVSRNLYLSLGIFLPLIAVN
    CAILGGVLFGITRNYPFIPMMIFSLGAG
    CGWWLAIVLFATIKEKLAYSDIPKNLQGMGISFITTGLIAMAFMSLTGIDISKPSTTVEAAHVLEDQKVSSAEVNEVKPI
    KKVRSAPQRTGKTKTINTKKGKLQ

    >gi|62184985|ref|YP_219770.1| Na(+)-translocating NADH-quinone reductase subunit D [Chlamydophila abortus S26/3]
    MAANKSYKSYFLDPLWNNNQPLIAILGICSALAVTTTVNTALTMGLAVSFVTGCSSFFVSLLRKVTPDSVRMITQLIIIS
    LFVIVIDQFLKAFFFDISKTLSVFVGLIITN
    CIVMGRAESLARNVPPIPAFLDGFASGLGYGWVLVTVSIIREFFGFGTI
    LGLQLIPKCFYASEAHPDGYENFGLMVLAPSAFFLLGIMIWGVNILRSKKERR

    >gi|62185083|ref|YP_219868.1| thioredoxin reductase [Chlamydophila abortus S26/3]
    MTYAKVIIIGSGPAGYTAAIYASRALLSPILFEGFFSGVAGGQLMTTTEVENFPGFPEGILGPKLMENMKSQSSRFGTQI
    LPKDVTSVDFTIRPFVVMSNEEKYTCDACIIATGASAKRLEIPGAADNEFWQKGVTA
    CAVCDGASPIFKNKDLYVIGGGD
    SALEEAIFLTRYGKRVFVVHRRDTLRASKAMIKKAESNEKISFLWNSSIVKISGDTFVRSVDILNNVSKEVSTRDAGGVF
    FAIGHRPNTDFLGGQLALDEHGYIITEPGTCRTSIPGVFAAGDVQDKHYRQAIIAAGSGCMAALEAERFLN

    >gi|62185180|ref|YP_219965.1| hypothetical protein CAB563 [Chlamydophila abortus S26/3]
    MNKKILVIVTSVFFVLCFGLMIYKKQTILPPKAHIPTNAKHFPTLGNRYAPINITVFEEPSCLACAEFSTEVFPLLKKNY
    IDTGEVSFTLIPVCFIRGSMPAAQALLCVYHHDPREPDIEAYTEYFHRLLIHPKEEGKHWATPQVLTKLTENLKTHSGRS
    INPKGLMQCIDSQRYEEQIKKNNIYGSQVLGGQLATPTAVVGDYLIEDPTFEELERVIRQIRYLQATEENHD

    >gi|62185413|ref|YP_220198.1| hypothetical protein CAB808 [Chlamydophila abortus S26/3]
    MSMKRWLQGSLIALCLLLTLPCCAAKRRSHYQKGIDKSTVHVVNTSGVQWESYNNAVEQSKKDKKYIGLFFTGSDWCIWC
    MKMQDQILNTTEFQQYAHEHLHMVELNFPQSASQPEDLKQQNQALKAKYGVNGFPTLVFIDAHGVEKARMGFEYGGGESY
    VQKIKAALRTK

    >gi|62185502|ref|YP_220287.1| dihydrolipoamide dehydrogenase [Chlamydophila abortus S26/3]
    MSTDFDCVVIGAGPGGYVAAITAAQQGLKTALIEEQQAGGTCLNRGCIPSKALLVGAGIVSQIKHANQFGIHIDGYSIDY
    PAMVQRKNTVINGIRQGLEGLIRSNKITVLHGRGSLISSTEVRVKGQDTSVTKSQYIIIATGSESRPFPGVPFSSRIL
    CS
    TGILNLTELPKKLAIIGGGVIGCEFASLFHTLGVEITIIEVAEQILSVNNADISKTMLDKFSRQGIRIITKASIHALEDL
    GDRVRITVNEQTEEYDYVLVAIGRQFNTTDIGLDNAGVIRDNRGIIPVDETMRTNVANIFAIGDITGKWLLAHVASHQGI
    VAGKNAASHNEIMDYSAVPAVIFTLPEVAMVGLSLEAAQQQGIPVKLTKFPFKAIGKAVAMAEADGFAAIISHETTQQIL
    GAYVVGPHAASLIAEMTLAVRNELTLPCIYETIHAHPTLAEVWAESALLATNHPLHLPPPKL

    >gi|62185540|ref|YP_220325.1| putative thiol:disulfide interchange protein [Chlamydophila abortus S26/3]
    MNKIKKHFQTLLIAFLFSLPAFTGQGQKLRAAEPVVETASPGATLISEGSHIPKAGTFRLGIKIAAPKGSHIYWKNPGEV
    GSPLRIHWILPKGFTVEEEHWPTPKVFEEEGVTFFGYDDQAFIVADIRAPESLDDQESVVLKAHVEWLACGGSCVPGNVN
    LELSLPYRDGAAILYPERTAEFAQTLQTQPRLLEDQTITLGRSQDGEIILNISGQKNRAEKAWFISEKADKIFAYSEEAV
    SEASGTAWKLKIKTLSGVQKNQELQGILLLTDKAGGEVASFAVRGQISDSESGTSALGNYVMIMIMAFLGGLLLNIMPCV
    LPLVTLKVYGLIKSAGEHRSSVIINGLCFTLGVVGCFWGLAGVVSLLKMLGHNIGWGFQLQEPMFVATLVIVFFLFALSS
    LGLFEMGTMFASLGGKLQSTESGGSKNKAVGAVFNGVLATLVTTPCTGPFLGSILGLVMSLSFIKQLLIFTSIGLGMALP
    YLVFSIFPKMLSVLPKPGSWMSTFKQLTGFMLLGTVTWLAWIFGSETSTTALIILLAGLWLTGIGAWILGKWGTPVSPKK
    HRVIASTVFLGFVAGALSLSFVASKHFVEATETAVVQENNVWQPFSSAKLAQLRKEGRAVFVNFTAKW
    CLTCQMNKPVLY
    ARAVQEMFKEHGVVTLEADWTRKDPEITEELARLGRASVPSYVYYPADQSDPIVLPEKITQSVLEDQVFSKN

    >gi|62185548|ref|YP_220333.1| putative alkyl hydroperoxide reductase [Chlamydophila abortus S26/3]
    MGSLFIGKTAPDFSVQAVVDGEVKNISLQDYRGKYVILFFYPKDFTYVCPTELHAFQDSLEEFENRGAQVIGCSVDDLDT
    HQRWLKTDKKAGGVKGITYPLISDTTHELSKLYNVLDSQSGLSFRGSFLIDKDGIIRHMVVNDLPLGRSIDEELRVLDAL
    IFFENHGLVCPANWQQGQRAMAPNEEGLKEYFGTID