Chlamydia trachomatis L2b UCH 1 proctitis

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|166154997|ref|YP_001653252.1| protein disulfide isomerase [Chlamydia trachomatis L2b/UCH-1/proctitis]
    MRNWLLGSLLIACMAVTAPCFAAKRRAAGSQKINRVAETGIHWMSYQDALNKAKQEGKHVAVFFTGSDWCIWCMRMQDQI
    LQTAAFSEFAKQYLCMVEIDFPHNKEQTAEQKEQNRHLKSLYSVDGFPTLVFLDSEGKEVAKMGFEPGGGEAYVYRLKQA
    LHIS

    >gi|166155195|ref|YP_001653450.1| thioredoxin reductase [Chlamydia trachomatis L2b/UCH-1/proctitis]
    MNVVCGKSRVGYSSFFCKSREPFSCVFKALLSKFILGVLMTHAKLVIIGSGPAGYTAAIYASRALLTPVLFEGFFSGIAG
    GQLMTTTEVENFPGFPEGVLGHQLMDLMKTQAQRFGTQVLSKDITAVDFSVRPFVLKSGEETFTCDACIIATGASAKRLS
    IPGAGDNEFWQKGVTA
    CAVCDGASPIFRDKDLFVVGGGDSALEEAMFLTRYGKRVFVVHRRDTLRASKVMVNKAQANEKI
    FFLWNSEIVKISGDTLVRSIDIYNNVDKTTTTMEAAGVFFAIGHQPNTAFLGGQVALDENGYIITEKGSSRTSVPGVFAA
    GDVQDKYYRQAITSAGSGCMAALDVERFLEN

    >gi|166155262|ref|YP_001653517.1| disulfide bond chaperone [Chlamydia trachomatis L2b/UCH-1/proctitis]
    MDTRTPLRKKILIISTALGFVLCVGLMIHTKRSIMPPKTHIPTTAKYFPTIGDPYAPINITVFEEPSCSACEEFSSEVFP
    LIKKHFVDTGEASLTLVPVCFIRGSMPAAQALLCVYHHDPKRPDPEAYMEYFHRILTYKKTKGSHWATPEVLAKLAEKIP
    THSGREINPKGLIQCINSQRFTEQLKKNNIYGSQIMGGQLATPTAVVGDYLIEDPTFDEIERVITQLRHLQAIEEEVR

    >gi|166155366|ref|YP_001653621.1| Na(+)-translocating NADH-quinone reductase subunit D [Chlamydia trachomatis L2b/UCH-1/proctitis]
    MTTNKSYLTYFTDALWINNQPLIAILGICSALAVTTTVTTALTMGFAVSFVTGCSSFVVSLLRKITPESVRMIAQLIIIS
    LFVILIDQFLKAFFFTISKTLSVFVGLIITN
    CIVMGRAESMARHVSPIPAFLDGLGSGLGYGWVLVCISIIRELFGFGTI
    LGFRVIPEILYASAAHPDGYENLGLMVLAPSAFFLLGIMIWIVNIIRAPKTKR

    >gi|166155367|ref|YP_001653622.1| Na(+)-translocating NADH-quinone reductase subunit E [Chlamydia trachomatis L2b/UCH-1/proctitis]
    MWLGDYSLLNLLGIFLQATFIQNILLSTFLGMCSYLACSSRLSTANGLGMSVALVLTITGSINWLVHYFITKPGALAWLS
    PALANIDLSFLELIMFIVVIAAFTQILELLLERFSRNLYLALGIFLPLIAVN
    CAILGGVLFGITRNYPFLPMVVFSLGSG
    CGWWLAIVLFATIREKLAYSDVPQHLRGTGISFITTGLMAMAFMGLTGIDISKPTTSKPAFVMNIATDSPQPNTHSSSEE
    PKAS

    >gi|166155566|ref|YP_001653821.1| putative DNA methyltransferase [Chlamydia trachomatis L2b/UCH-1/proctitis]
    MAEKFFVVSPTSKNCLAQACSQGLPINRTPPIQIIVHFRGDSIFHSRLSPAPVFTCLFLGPGAHKAMEGLVRWCEAYANK
    MPPKLSFLDLSSFKEKRLAILQEIRQIPFGTRHTCEEIAERTKTHTEEVLIACQENPLPLLIP
    CHRVLSIHDYPGGEKLY
    KALTEFEELS

    >gi|166155629|ref|YP_001653884.1| thioredoxin [Chlamydia trachomatis L2b/UCH-1/proctitis]
    MVQVVSQENFADSIASGLVLIDFFAEWCGPCKMLTPVLEALAAELPHVTILKVDIDSSPRPAEQYSVSSIPTLILFKDGK
    EVERSVGLKDKDSLIKLISKHQ

    >gi|166155647|ref|YP_001653902.1| dihydrolipoamide dehydrogenase [Chlamydia trachomatis L2b/UCH-1/proctitis]
    MNEAFDCVVIGAGPGGYVAAITAAQAGLKTALIEKREAGGTCLNRGCIPSKALLAGAEVVTQIRHADQFGIHVEGFSINY
    PAMVQRKDSVVRSIRDGLNGLIRSNKITVFSGRGSLISSTEVKILGENPSVIKAHSIILATGSEPRAFPGIPFSAESPRI
    L
    CSTGVLNLKEIPQKMAIIGGGVIGCEFASLFHTLGSEVSVIEASSQILALNNPDISKTMFDKFTRQGLRFVLEASVSNI
    EDIGDRVRLTINGNVEEYDYVLVSIGRRLNTENIGLDKAGVICDERGVIPTDATMRTNVPNIYAIGDITGKWQLAHVASH
    QGIIAARNIGGHKEEIDYSAVPSVIFTFPEVASVGLSPTAAQQQKIPVKVTKFPFRAIGKAVAMGEADGFAAIISHETTQ
    QILGAYVIGPHASSLISEITLAVRNELTLPCIYETIHAHPTLAEVWAESALLAVDTPLHMPPAKK

    >gi|166155684|ref|YP_001653939.1| thiol:disulfide interchange protein [Chlamydia trachomatis L2b/UCH-1/proctitis]
    MIRQWYGFFLCLLFSYTSCFGVEENSGRATPTVELVSESEQAVEGEVLRIGVLIAIPEGEHIYWKNPGKLGMPLRISWDL
    PSGCRLLEEHWPTPEIFEEDGVVYFGYKHSTMVVADIRVSKEIETRPLEIKAQVEWLSCGASCLPGSSSRVLVIPIDQGP
    LIPNSKETFTFSRALAAQPRPLDAAIKISYQPDGLDVLVPAGKADRATQAWFIAENTRDFAYAQEVPLEQATTYIWKLKH
    PEGNMPKGVGLSGILIFKDDAGKVVASYQVEENQVEQLSALSWGFLSILLMAFIGGILLNIMPCVLPLITLKVFSLIKSA
    ADHHSSSVIGGIWFTLGAIVSFWGLAFCAFLLKVLGQNIGWGFQLQEPMFVAVLIIVFFLFALSSLGVFEMGMICLSLGE
    KLQEEGGASVRKNQIWGAFFNGMLTTLVTTPCTGPFLGSVFGLVMAVSFVKQLAIFTAIGLGMASPYLLFASFPKMLAIL
    PKPGPWMSTFKQLTGFMLLATATWLIWIFGVETSATAVTILLVGLWLAAVGAWILGRWGTLVSPRNQRLLASVVFIFCIL
    SSLVITSIGVRYFDENVPPAHSFDWQSFSPEKLADLREKGIPVFVNFTAKW
    CLTCQLNKPLLHANMQAFAAKGVVTLEAD
    WTKKDPKITEELARLGRASVPSYVYYPAGNKAPLILPERLSQSALEEMVFSQ

    >gi|166155692|ref|YP_001653947.1| thioredoxin peroxidase [Chlamydia trachomatis L2b/UCH-1/proctitis]
    MGSLVGRQAPDFSGKAVVCGEEKEISLADFRGKYVVLFFYPKDFTYVCPTELHAFQDRLVDFEEHGAVVLGCSVDDIETH
    SRWLTVARDAGGIEGTEYPLLADPSFKISEAFGVLNPEGSLALRATFLIDKHGVIRHAVINDLPLGRSIDEELRILDSLI
    FFENHGMVCPANWRSGERGMVPSEEGLKEYFQTMD

    >gi|166155717|ref|YP_001653972.1| hypothetical protein CTLon_0885 [Chlamydia trachomatis L2b/UCH-1/proctitis]
    MEKNYYALAYYYFGPVSNPYEEIALHKQLFKTMDVSCRIYISEEGINGQFSGYQPDAERYMAWLKQRPDFASIKFKIHHI
    EENIFPRVTVKYRKELVALGCSVDTTKQGKHISPEEWHEKLQENRCLVLDVRNNYEWKIGHFENAVLPDIETFREFPDYA
    DRLAKEHDPAKTPVMMY
    CTGGIRCELYSALLLEKGFKEVYQLDGGVIAYGLKMGTGKWRGKLFVFDDRMAMPIDEADPNV
    SPIARCSLCNTDSDTYYNCANTDCNNLFICCESCIATHKGCCSEECSQAPRIRAFSAERGNKPFRRKHLCPTIEQSCCLK
    EQENQPA