Chlamydia trachomatis D UW 3 CX uid57637

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|15604818|ref|NP_219602.1| thioredoxin reductase [Chlamydia trachomatis D/UW-3/CX]
    MNVVCGKSRVGYSSFFCKSREPFSCVFKALLSKFILGVPMTHAKLVIIGSGPAGYTAAIYASRALLTPVLFEGFFSGIAG
    GQLMTTTEVENFPGFPEGVLGHQLMDLMKTQAQRFGTQVLSKDITAVDFSVRPFVLKSGKETFTCDACIIATGASAKRLS
    IPGAGDNEFWQKGVTA
    CAVCDGASPIFRDKDLFVVGGGDSALEEAMFLTRYGKRVFVVHRRDTLRASKVMVNKAQANEKI
    FFLWNSEIVKISGDTLVRSIDIYNNVDETTTTMEAAGVFFAIGHQPNTAFLGGQVALDENGYIITEKGSSRTSVPGVFAA
    GDVQDKYYRQAITSAGSGCMAALDAERFLEN

    >gi|15604897|ref|NP_219681.1| disulfide bond chaperone [Chlamydia trachomatis D/UW-3/CX]
    MDTRTPLRKKILIISTALGFVLCVGLMIHTKRSIMPPKTHIPTTAKYFPTIGDPYAPINITVFEEPSCSACEEFSSEVFP
    LIKKHFVDTGEASLTLVPVCFIRGSMPAAQALLCVYHHDPKRPDPEAYMEYFHRILTYKKTKGSHWATPEVLAKLAEKIP
    THSGREINLKGLIQCINSQRFTEQLKKNNIYGSQIMGGQLATPTAVVGDYLIEDPTFDEIERVITQLRHLQAIEEEVR

    >gi|15605001|ref|NP_219785.1| Na(+)-translocating NADH-quinone reductase subunit D [Chlamydia trachomatis D/UW-3/CX]
    MTTNKSYLTYFTDALWINNQPLIAILGICSALAVTTTVTTALTMGFAVSFVTGCSSFVVSLLRKITPESVRMIAQLIIIS
    LFVILIDQFLKAFFFTISKTLSVFVGLIITN
    CIVMGRAESMARHVSPIPAFLDGLGSGLGYGWVLVCISIIRELFGFGTI
    LGFRVIPEILYTSAAHPDGYENLGLMVLAPSAFFLLGIMIWIVNIIRAPKTKR

    >gi|15605002|ref|NP_219786.1| Na(+)-translocating NADH-quinone reductase subunit E [Chlamydia trachomatis D/UW-3/CX]
    MWLGDYSLLNLLGIFLQATFIQNILLSTFLGMCSYLACSSRLSTANGLGMSVALVLTITGSINWLVHYFITKPGALAWLS
    PALANIDLSFLELIMFIVVIAAFTQILEVLLERFSRNLYLALGIFLPLIAVN
    CAILGGVLFGITRNYPFLPMVVFSLGSG
    CGWWLAIVLFATIREKLAYSDVPQHLRGTGISFITTGLMAMAFMGLTGIDISKPTTSKPAFVTNIATDSPQPNTHSSSEE
    PKAS

    >gi|15605204|ref|NP_219990.1| methylated-DNA protein - cysteine methyltransferase [Chlamydia trachomatis D/UW-3/CX]
    MAEEFFVVSPTSKNCLAQACSQGLAINRTPPIQIIVHFRGDSIFHSRLSPAPVFTCLFLGPGAHKAMEGLVRWCEAYANK
    MPPKLSFLDLSSFKEKRLAIPQEIRQIPFGTRHTCEEIAERTKTHTEEVLIACQENPLPLLIP
    CHRVLSIHDYPGGEKLY
    KALTAFEELS

    >gi|15605268|ref|NP_220054.1| thioredoxin [Chlamydia trachomatis D/UW-3/CX]
    MVQVVSQENFADSIASGLVLIDFFAEWCGPCKMLTPVLEALAAELPHVTILKVDIDSSPRPAEQYSVSSIPTLILFKDGK
    EVERSVGLKDKDSLIKLISKHQ

    >gi|15605286|ref|NP_220072.1| dihydrolipoamide dehydrogenase [Chlamydia trachomatis D/UW-3/CX]
    MNEAFDCVVIGAGPGGYVAAITAAQAGLKTALIEKREAGGTCLNRGCIPSKALLAGAEVVTQIRHADQFGIHVEGFSINY
    PAMVQRKDSVVRSIRDGLNGLIRSNKITVFSGRGSLISSTEVKILGENPSVIKAHSIILATGSEPRAFPGIPFSAESPRI
    L
    CSTGVLNLKEIPQKMAIIGGGVIGCEFASLFHTLGSEVSVIEASSQILALNNPDISKTMFDKFTRQGLRFVLEASVSNI
    EDIGDRVRLTINGNVEEYDYVLVSIGRRLNTENIGLDKAGVICDERGVIPTDATMRTNVPNIYAIGDITGKWQLAHVASH
    QGIIAARNIAGHKEEIDYSAVPSVIFTFPEVASVGLSPTAAQQQKIPVKVTKFPFRAIGKAVAMGEADGFAAIISHETTQ
    QILGAYVIGPHASSLISEITLAVRNELTLPCIYETIHAHPTLAEVWAESALLAVDTPLHMPPAKK

    >gi|15605325|ref|NP_220111.1| Thio:disulfide interchange protein [Chlamydia trachomatis D/UW-3/CX]
    MIRQWYGFFLCLLFSYTSCFGVEENSGRATPTVELVSESEQAVEGEVLRIGVLIAIPEGEHIYWKNPGKLGMPLRISWDL
    PSGCRLLEEHWPTPEIFEEDGVVYFGYKHSTMVVADIRVSKEIETRPLEIKAQVEWLSCGASCLPGSSSRVLVIPIDQGP
    LIPNSKETFTFSRALAAQPRPLDAAIKISYQPDGLDVFVPAGKADRATQAWFIAENTRDFAYAQEVPLEQATTYIWKLKH
    PEGNMPKGIGLSGILIFKDDAGKVVASYQVEENQVEQLSALSWRFLSILLMAFIGGILLNIMPCVLPLITLKVFSLIKSA
    ADHHSSSVIGGIGFTLGAIVSFWGLAFCAFLLKVLGQNIGWGFQLQEPMFVAVLIIVFFLFALSSLGVFEMGIICLSLGK
    KLQEEGGASVRKNQIWGAFFNGMLTTLVTTPCTGPFLGSVFGLVMAVSFVKQLAIFTAIGLGMASPYLLFASFPKMLAIL
    PKPGPWMSTFKQLTGFMLLATATWLIWIFGVETSATAVTILLVGLWLAAVGAWILGRWGTLVSPRNQRLLASVVFIFCIL
    SSLVITSIGVRYFDENVPPAHSSDWQSFSPEKLADLREKGIPVFVNFTAKW
    CLTCQLNKPLLHANMQAFAAKGVVTLEAD
    WTKKDPKITEELARLGRASVPSYVYYPAGNKAPLILPERLSQSALEEMVFSQ

    >gi|15605333|ref|NP_220119.1| thioredoxin peroxidase [Chlamydia trachomatis D/UW-3/CX]
    MGSLVGRQAPDFSGKAVVCGEEKEISLADFRGKYVVLFFYPKDFTYVCPTELHAFQDRLVDFEERGAVVLGCSVDDIETH
    SRWLAVARNAGGIEGTEYPLLADPSFKISEAFGVLNPEGSLALRATFLIDKYGVVRHAVINDLPLGRSIDEELRILDSLI
    FFENHGMVCPANWRSGERGMVPSEEGLKEYFQTMD

    >gi|15605358|ref|NP_220144.1| hypothetical protein CT627 [Chlamydia trachomatis D/UW-3/CX]
    MEKNYYALAYYYFGPVSNPHEEIALHKQLFKTMDVSCRIYISEEGINGQFSGYQPDAERYMAWLKQRPDFASIKFKIHHI
    EENIFPRVTVKYRKELVALGCSVDTTKQGKHISPEEWHEKLQENRCLVLDVRNNYEWKIGHFENAVLPDIETFREFPDYA
    DRLAKEHDPAKTPVMMY
    CTGGIRCELYSALLLEKGFKEVYQLDGGVIAYGLKMGTGKWRGKLFVFDDRMAMPIDEADPNV
    SPIARCSLCNTDSDTYYNCANTDCNNLFICCESCIATHKGCCSEECSQAPRIRAFSAERGNKPFRRKHLCPTIEQSCCLK
    EQENQPA

    >gi|15605513|ref|NP_220299.1| protein disulfide isomerase [Chlamydia trachomatis D/UW-3/CX]
    MRNWLLGSLLIACMAVTAPCFAAKRRAAGSQKINRVAETGIHWMSYQDALNKAKQEGKHVAVFFTGSDWCIWCMRMQDQI
    LQTAAFSEFAKQYLCMVEIDFPHNKEQTAEQKEQNRHLKSLYSVDGFPTLVLLDSEGKEVAKMGFEPGGGEAYVYRLKKA
    LHIS