Chlamydia trachomatis B TZ1A828 OT uid59349

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|237804448|ref|YP_002888602.1| thioredoxin reductase [Chlamydia trachomatis B/TZ1A828/OT]
    MNVVCGKSRVGYSSFFCKSREPFSCVFKALLSKFILGVPMTHAKLVIIGSGPAGYTAAIYASRALLTPVLFEGFFSGIAG
    GQLMTTTEVENFPGFPEGVLGHQLMDLMKTQAQRFGTQVLSKDITAVDFSVRPFVLKSGKETFTCDACIIATGASAKRLS
    IPGAGDNEFWQKGVTA
    CAVCDGASPIFRDKDLFVVGGGDSALEEAMFLTRYGKRVFVVHRRDTLRASKVMVNKAQANEKI
    FFLWNSEIVKISGDTLVRSIDIYNNVDETTTTMEAAGVFFAIGHQPNTAFLGGQVALDENGYIITEKGSSRTSVPGVFAA
    GDVQDKYYRQAITSAGSGCMAALDAERFLEN

    >gi|237804523|ref|YP_002888677.1| disulfide bond chaperone [Chlamydia trachomatis B/TZ1A828/OT]
    MDTRTPLRKKILIISTALGFVLCVGLMIHTKRSIMPPKTHIPTTAKYFPTIGDPYAPINITVFEEPSCSACEEFSSEVFP
    LIKKHFVDTGEASLTLVPVCFIRGSMPAAQALLCVYHHDPKRPDPEAYMEYFHRILTYKKTKGSHWATPEVLAKLAEKIP
    THSGREINPKGLIQCINSQRFTEQLKKNNIYGSQIMGGQLATPTAVVGDYLIEDPTFDEIERVITQLRHLQAIEEEVR

    >gi|237804625|ref|YP_002888779.1| Na(+)-translocating NADH-quinone reductase subunit D [Chlamydia trachomatis B/TZ1A828/OT]
    MTTNKSYLTYFTDALWINNQPLIAILGICSALAVTTTVTTALTMGFAVSFVTGCSSFVVSLLRKITPESVRMIAQLIIIS
    LFVILIDQFLKAFFFTISKTLSVFVGLIITN
    CIVMGRAESMARHVSPIPAFLDGLGSGLGYGWVLVCISIIRELFGFGTI
    LGFRVIPEILYTSAAHPDGYENLGLMVLAPSAFFLLGIMIWIVNIIRAPKTKR

    >gi|237804626|ref|YP_002888780.1| Na(+)-translocating NADH-quinone reductase subunit E [Chlamydia trachomatis B/TZ1A828/OT]
    MWLGDYSLLNLLGIFLQATFIQNILLSTFLGMCSYLACSSRLSTANGLGMSVALVLTITGSINWLVHYFITKPGALAWLS
    PALANIDLSFLELIMFIVVIAAFTQILEVLLERFSRNLYLALGIFLPLIAVN
    CAILGGVLFGITRNYPFLPMVVFSLGSG
    CGWWLAIVLFATIREKLAYSDVPQHLRGTGISFITTGLMAMAFMGLTGIDISKPTTSKPAFVTNIATDSPQPNTHSSSEE
    PKAS

    >gi|237804827|ref|YP_002888981.1| putative DNA methyltransferase [Chlamydia trachomatis B/TZ1A828/OT]
    MAEKFFVVSPTSKNCLAQACSQGLAINRTPPIQIIVHFRGDSIFHSRLSPAPVFTCLFLGPGAHKAMEGLVRWCEAYANK
    MPPKLSFLDLSSFKEKRLAIPQEIRQIPFGTRHTCEEIAERTKTHTEEVLIACQENPLPLLIP
    CHRVLSIHDYPGGEKLY
    KALTAFEELS

    >gi|237804890|ref|YP_002889044.1| thioredoxin [Chlamydia trachomatis B/TZ1A828/OT]
    MVQVVSQENFADSIASGLVLIDFFAEWCGPCKMLTPVLEALAAELPHVTILKVDIDSSPRPAEQYSVSSIPTLILFKDGK
    EVERSVGLKDKDSLIKLISKHQ

    >gi|237804908|ref|YP_002889062.1| dihydrolipoamide dehydrogenase [Chlamydia trachomatis B/TZ1A828/OT]
    MNEAFDCVVIGAGPGGYVAAITAAQAGLKTALIEKREAGGTCLNRGCIPSKALLAGAEVVTQIRHADQFGIHVEGFSINY
    PAMVQRKDSVVRSIRDGLNGLIRSNKITVFSGRGSLISSTEVKILGENPSVIKAHSIILATGSEPRAFPGIPFSAESPRI
    L
    CSTGVLNLKEIPQKMAIIGGGVIGCEFASLFHTLGSEVSVIEASSQILALNNPDISKTMFDKFTRQGLRFVLEASVSNI
    EDIGDRVRLTINGNVEEYDYVLVSIGRRLNTENIGLDKAGVICDERGVIPTDATMRTNVPNIYAIGDITGKWQLAHVASH
    QGIIAARNIAGHKEEIDYSAVPSVIFTFPEVASVGLSPTAAQQQKIPVKVTKFPFRAIGKAVAMGEADGFAAIISHETTQ
    QILGAYVIGPHASSLISEITLAVRNELTLPCIYETIHAHPTLAEVWAESALLAVDTPLHMPPAKK

    >gi|237804944|ref|YP_002889098.1| thiol:disulfide interchange protein [Chlamydia trachomatis B/TZ1A828/OT]
    MIRQWYGFFLCLLFSYTSCFGVEENSGRATPTVELVSESEQAVEGEVLRIGVLIAIPEGEHIYWKNPGKLGMPLRISWDL
    PSGCRLLEEHWPTPEIFEEDGVVYFGYKHSTMVVADIRVSKEIETRPLEIKAQVEWLSCGASCLPGSSSRVLVIPIDQGP
    LIPNSKETFTFSRALAAQPRPLDAAIKISYQPDGLDVLVPAGKADRATQAWFIAENTRDFAYAQEVPLEQATTYIWKLKH
    PEGNMPKGIGLSGILIFKDDAGKVVASYQVEENQVEQLSALSWRFLSILLMAFIGGILLNIMPCVLPLITLKVFSLIKSA
    ADHHSSSVIGGIGFTLGAIVSFWGLAFCAFLLKVLGQNIGWGFQLQEPMFVAVLIIVFFLFALSSLGVFEMGIICLSLGK
    KLQEEGGASVRKNQIWGAFFNGMLTTLVTTPCTGPFLGSVFGLVMAVSFVKQLAIFTAIGLGMASPYLLFASFPKMLAIL
    PKPGPWMSTFKQLTGFMLLATATWLIWIFGVETSATAVTILLVGLWLAAVGAWILGRWGTLVSPRNQRLLASVVFIFCIL
    SSLVITSIGVRYFDENVPPAHSSDWQSFSPEKLADLREKGIPVFVNFTAKW
    CLTCQLNKPLLHANMQAFAAKGVVTLEAD
    WTKKDPKITEELARLGRASVPSYVYYPAGNKAPLILPERLSQSALEEMVFSQ

    >gi|237804952|ref|YP_002889106.1| thioredoxin peroxidase [Chlamydia trachomatis B/TZ1A828/OT]
    MGSLVGRQAPDFSGKAVVCGEEKEISLADFRGKYVVLFFYPKDFTYVCPTELHAFQDRLVDFEERGAVVLGCSVDDIETH
    SRWLAVARNAGGIEGTEYPLLADPSFKISEAFGVLNPEGSLALRATFLIDKYGVVRHAVINDLPLGRSIDEELRILDSLI
    FFENHGMVCPANWRSGERGMVPSEEGLKEYFQTMD

    >gi|237804977|ref|YP_002889131.1| hypothetical protein CTB_6311 [Chlamydia trachomatis B/TZ1A828/OT]
    MEKNYYALAYYYFGPVSNPHEEIALHKQLFKTMDVSCRIYISEEGINGQFSGYQPDAERYMAWLKQRPDFASIKFKIHHI
    EENIFPRVTVKYRKELVALGCSVDTTKQGKHISPEEWHEKLQENRCLVLDVRNNYEWKIGHFENAVLPDIETFREFPDYA
    DRLAKEHDPAKTPVMMY
    CTGGIRCELYSALLLEKGFKEVYQLDGGVIAYGLKMGTGKWRGKLFVFDDRMAMPIDEADPNV
    SPIARCSLCNTDSDTYYNCANTDCNNLFICCESCIATHKGCCSEECSQAPRIRAFSAERGNKPFRRKHLCPTIEQSCCLK
    EQENQPA

    >gi|237805131|ref|YP_002889285.1| protein disulfide isomerase [Chlamydia trachomatis B/TZ1A828/OT]
    MRNWLLGSLLIACMAVTAPCFAAKRRAAGSQKINRVAETGIHWMSYQDALNKAKQEGKHVAVFFTGSDWCIWCMRMQDQI
    LQTAAFSEFAKQYLCMVEIDFPHNKEQTAEQKEQNRHLKSLYSVDGFPTLVLLDSEGKEVAKMGFEPGGGEAYVYRLKKA
    LHIS