Chlamydia trachomatis A HAR 13 uid58333

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|76788813|ref|YP_327899.1| thioredoxin reductase [Chlamydia trachomatis A/HAR-13]
    MNVVCGKSRVGYSSFFCKSREPFSCVFKALLSKFILGVPMTHAKLVIIGSGPAGYTAAIYASRALLTPVLFEGFFSGIAG
    GQLMTTTEVENFPGFPEGVLGHQLMDLMKTQAQRFGTQVLSKDITAVDFSVRPFVLKSGKETFTCDACIIATGASAKRLS
    IPGAGDNEFWQKGVTA
    CAVCDGASPIFRDKDLFVVGGGDSALEEAMFLTRYGKRVFVVHRRDTLRASKVMVNKAQANEKI
    FFLWNSEIVKISGDTLVRSIDIYNNVDETTTTMEAAGVFFAIGHQPNTAFLGGQVALDENGYIITEKGSSRTSVPGVFAA
    GDVQDKYYRQAITSAGSGCMAALDAERFLENRALCLV

    >gi|76788899|ref|YP_327985.1| disulfide bond chaperone [Chlamydia trachomatis A/HAR-13]
    MDTRTPLRKKILIISTALGFVLCVGLMIHTKRSIMPPKTHIPTTAKYFPTIGDPYAPINITVFEEPSCSACEEFSSEVFP
    LIKKHFVDTGEASLTLVPVCFIRGSMPAAQALLCVYHHDPKRPDPEAYMEYFHRILTYKKTKGSHWATPEVLAKLAEKIP
    THSGREINPKGLIQCINSQRFTEQLKKNNIYGSQIMGGQLATPTAVVGDYLIEDPTFDEIERVITQLRHLQAIEEEVR

    >gi|76789002|ref|YP_328088.1| Na(+)-translocating NADH-quinone reductase subunit D [Chlamydia trachomatis A/HAR-13]
    MTTNKSYLTYFTDALWINNQPLIAILGICSALAVTTTVTTALTMGFAVSFVTGCSSFVVSLLRKITPESVRMIAQLIIIS
    LFVILIDQFLKAFFFTISKTLSVFVGLIITN
    CIVMGRAESMARHVSPIPAFLDGLGSGLGYGWVLVCISIIRELFGFGTI
    LGFRVIPEILYTSAAHPDGYENLGLMVLAPSAFFLLGIMIWIVNIIRAPKTKR

    >gi|76789003|ref|YP_328089.1| Na(+)-translocating NADH-quinone reductase subunit E [Chlamydia trachomatis A/HAR-13]
    MWLGDYSLLNLLGIFLQATFIQNILLSTFLGMCSYLACSSRLSTANGLGMSVALVLTITGSINWLVHYFITKPGALAWLS
    PALANIDLSFLELIMFIVVIAAFTQILEVLLERFSRNLYLALGIFLPLIAVN
    CAILGGVLFGITRNYPFLPMVVFSLGSG
    CGWWLAIVLFATIREKLAYSDVPQHLRGTGISFITTGLMAMAFMGLTGIDISKPTTSKPAFVTNIATDSPQPNTHSSSEE
    PKAS

    >gi|76789213|ref|YP_328299.1| o6-methylguanine-DNA methyltransferase [Chlamydia trachomatis A/HAR-13]
    MAEKFFVVSPTSKNCLAQACSQGLAINRTPPIQIIVHFRGDSIFHSRLSPAPVFTCLFLGPGAHKAMEGLVRWCEAYANK
    MPPKLSFLDLSSFKEKRLAIPQEIRQIPFGTRHTCEEIAERTKTHTEEVLIACQENPLSLLIP
    CHRVLSIHDYPGGEKLY
    KALTAFEELS

    >gi|76789276|ref|YP_328362.1| thioredoxin [Chlamydia trachomatis A/HAR-13]
    MVQVVSQENFADSIASGLVLIDFFAEWCGPCKMLTPVLEALAAELPHVTILKVDIDSSPRPAEQYSVSSIPTLILFKDGK
    EVERSVGLKDKDSLIKLISKHQ

    >gi|76789294|ref|YP_328380.1| dihydrolipoamide dehydrogenase [Chlamydia trachomatis A/HAR-13]
    MNEAFDCVVIGAGPGGYVAAITAAQAGLKTALIEKREAGGTCLNRGCIPSKALLAGAEVVTQIRHADQFGIHVEGFSINY
    PAMVQRKDSVVRSIRDGLNGLIRSNKITVFSGRGSLISSTEVKILGENPSVIKAHSIILATGSEPRAFPGIPFSAESPRI
    L
    CSTGVLNLKEIPQKMAIIGGGVIGCEFASLFHTLGSEVSVIEASSQILALNNPDISKTMFDKFTRQGLRFVLEASVSNI
    EDIGDRVRLTINGNVEEYDYVLVSIGRRLNTENIGLDKAGVICDERGVIPTDATMRTNVPNIYAIGDITGKWQLAHVASH
    QGIIAARNIAGHKEEIDYSAVPSVIFTFPEVASVGLSPTAAQQQKIPVKVTKFPFRAIGKAVAMGEADGFAAIISHETTQ
    QILGAYVIGPHASSLISEITLAVRNELTLPCIYETIHAHPTLAEVWAESALLAVDTPLHMPPAKK

    >gi|76789333|ref|YP_328419.1| DsbD [Chlamydia trachomatis A/HAR-13]
    MIRQWYGFFLCLLFSYTSCFGVEENSGRATPTVELVSESEQAIEGEVLRIGVLIAIPEGEHIYWKNPGKLGMPLRISWDL
    PSGCRLLEEHWPTPEIFEEDGVVYFGYKHSTMVVADIRVSKEIETRPLEIKAQVEWLSCGASCLPGSSSRVLVIPIDEGP
    LIPNSKETFTFSRALAAQPRPLDAAIKISYQPDGLDVLVPAGKADRATQAWFIAENTRDFAYAQEVPLEQATTYIWKLKH
    PEGNMPKGIGLSGILIFKDDAGKVVASYQVEENQVEQLSALSWRFLSILLMAFIGGILLNIMPCVLPLITLKVFSLIKSA
    ADHHSSSVIGGIGFTLGAIVSFWGLAFCAFLLKVLGQNIGWGFQLQEPMFVAVLIIVFFLFALSSLGVFEMGIICLSLGK
    KLQEEGGASVRKNQIWGAFFNGMLTTLVTTPCTGPFLGSVFGLVMAVSFVKQLAIFTAIGLGMASPYLLFASFPKMLAIL
    PKPGPWMSTFKQLTGFMLLATATWLIWIFGVETSATAVTILLVGLWLAAVGAWILGRWGTLVSPRNQRLLASVVFIFCIL
    SSLVITSIGVRYFDENVPPAHSSDWQSFSPEKLADLREKGIPVFVNFTAKW
    CLTCQLNKPLLHANMQAFAAKGVVTLEAD
    WTKKDPKITEELARLGRASVPSYVYYPAGNKAPLILPERLSQSALEEMVFSQ

    >gi|76789341|ref|YP_328427.1| thioredoxin peroxidase [Chlamydia trachomatis A/HAR-13]
    MFLSRRSIMGSLVGRQAPDFSGKAVVCGEEKEISLADFRGKYVVLFFYPKDFTYVCPTELHAFQDRLVDFEERGAVVLGC
    SVDDIETHSRWLAVARNAGGIEGTEYPLLADPSFKISEAFGVLNPEGSLALRATFLIDKYGVVRHAVINDLPLGRSIDEE
    LRILDSLIFFENHGMVCPANWRSGERGMVPSEEGLKEYFQTMD

    >gi|76789366|ref|YP_328452.1| hypothetical protein CTA_0680 [Chlamydia trachomatis A/HAR-13]
    MEKNYYALAYYYFGPVSNPHEEIALHKQLFKTMDVSCRIYISEEGINGQFSGYQPDAERYMAWLKQRPDFASIKFKIHHI
    EENIFPRVTVKYRKELVALGCSVDTTKQGKHISPEEWHEKLQENRCLVLDVRNNYEWKIGHFENAVLPDIETFREFPDYA
    DRLAKEHDPAKTPVMMY
    CTGGIRCELYSALLLEKGFKEVYQLDGGVIAYGLKMGTGKWRGKLFVFDDRMAMPIDEADPNV
    SPIARCSLCNTDSDTYYNCANTDCNNLFICCESCIATHKGCCSEECSQAPRIRAFSAERGNKPFRRKHLCPTIEQSCCLK
    EQENQPA

    >gi|76789522|ref|YP_328608.1| protein disulfide isomerase [Chlamydia trachomatis A/HAR-13]
    MRNWLLGSLLIACMAVTAPCFAAKRRAAGSQKINRVAETGIHWMSYQDALNKAKQEGKHVAVFFTGSDWCIWCMRMQDQI
    LQTAAFSEFAKQYLCMVEIDFPHNKEQTAEQKEQNRHLKSLYSVDGFPTLVLLDSEGKEVAKMGFEPGGGEAYVYRLKKA
    LHIS