Actinobacillus succinogenes 130Z uid58247

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|152977776|ref|YP_001343405.1| rhodanese domain-containing protein [Actinobacillus succinogenes 130Z]
    MAFTEITPERAWDMIQTENAVLLDVRDAERFSYSRAQGAFHLTNQSYGEFQDTYDFDHPVIVSCYHGISSRSIAAFLAEQ
    GYDNVYSVIGGFEGWQRAGLPMETAYGVKPI

    >gi|152977873|ref|YP_001343502.1| glutathione S-transferase domain-containing protein [Actinobacillus succinogenes 130Z]
    MKLYYLKGACSLVPHIALEWIGKPFEAVEVSHEQIKSPEYLALNPQGVVPLLQDGDFVLSQNVAILSYLDALYPDAKLFG
    SVTVQDKAKAMKWLAFCNADLHKAFGPVFRPPVYAQGDDELLTRIRQTAGRQILDLLAIADDCLAKQIFLGERISVADAY
    LYVELRWCKGLGLDYGHLRNLEAFYRRVSENVGVQAALKAQGLPV

    >gi|152977992|ref|YP_001343621.1| DSBA oxidoreductase [Actinobacillus succinogenes 130Z]
    MKKTLFALISAVAVVMSLNVQAAELKEGEQYVTVAQNPSAQPEVIEFFSFYCQHCYSFEMQYKIPEKVKAELPQGTIFKQ
    YHVDFLGHQSENLTRAWALAMALGVESKVKQSLFESAQANALRSMDDIRQKFIDNGITAEQFDGGINSFAVNALVKKQQN
    LAEQFKVQGVPDFYVNGKYRVNPEGLSHDDFVGDYIKTTIELLKK

    >gi|152978063|ref|YP_001343692.1| thioredoxin-dependent thiol peroxidase [Actinobacillus succinogenes 130Z]
    MNTLKPGENAPHFTLPNQHNEPVSLTDFQGKKVLIYFYPKALTPGCTIQACGLRDAKAELDKSGVIILGISPDSPKKLAQ
    FEEKQALNFTLLSDEDHQVAEQFGVWGEKKFMGKVYDGIHRISFLIDENGKIEQVFTKFKTGEHHQVVLNYLTEK

    >gi|152978071|ref|YP_001343700.1| rhodanese domain-containing protein [Actinobacillus succinogenes 130Z]
    MEEFLTLATPFIKNHTLMVVGWVAIFIAFIYVNFKAITSKVKLVSNAEAVALINNQNAVVIDLRTIEEFKRGHIVNSKEF
    VPSDIKNHNLGKLEQHKDVPVILV
    CASGITARSSGEILAKQGFNHVYVLQEGIAGWNAENLPLVK

    >gi|152978074|ref|YP_001343703.1| glutaredoxin family protein [Actinobacillus succinogenes 130Z]
    MSMEGKKIPQVTFHTRQGDAWVDVTTSELFDNKTVVLFSLPGAFTPTCSSTHLPRYNELACEFKALGVDDIICMSVNDTF
    VMNAWKADQEAENITVIPDGNGEFTEGMGMLVDKEELGFGKRSWRYSMLVRNGVVEKMFVEPNEPGDPFKVSDADTMIKY
    LKPDWTAKPSVSIFTKPG
    CPFCAKAKGLLKVKGYTFEEIVLGRDASTISVRAITGKTSVPQVFIGGEYIGGSEDLEKYFA


    >gi|152978282|ref|YP_001343911.1| Na(+)-translocating NADH-quinone reductase subunit D [Actinobacillus succinogenes 130Z]
    MAGSNLKKLLLSPIADNNPIALQILGICSALAVTTQLQTALVMAVAVSLVTGFASLFISCIRNYIPNNIRIIVQMAIIAS
    LVILVDQILRAYAYDLSKQLSVFVGLIITN
    CIVMGRAEAFAMKSAPLESFVDGIGNGLGYGAILLIVAFLRELIGSGKIF
    GVTVFETIQNGGWYQANGLFLLAPSAFFIIGFIIWGLRTWKPAQQEK

    >gi|152978283|ref|YP_001343912.1| Na(+)-translocating NADH-quinone reductase subunit E [Actinobacillus succinogenes 130Z]
    MEHYISLFVKSVFIENMALSFFLGMCTFLAVSKKVSTSFGLGIAVIVVLGIAVPVNQLVYTHILKENALVDGVDLSFLNF
    ITFIGVIAALVQILEMFLDKFVPSLYSALGIFLPLITVN
    CAIFGGVSFMVQREYNFTESVVYGIGAGTGWMLAIVALAGL
    TEKMKYADVPAGLRGLGITFITVGLMALGFMSFSGIQL

    >gi|152978330|ref|YP_001343959.1| alkylhydroperoxidase [Actinobacillus succinogenes 130Z]
    MSQFQIHTVETAPEASKETLKAVQNANGFIPNLIGVLANAPTALETYRTVGAINGRNSLTATEREVVQITAAVVNGCGFC
    VAGHTKIALKLLKVPQEVVNALRATARIEADPKLDTLARFTMAVIGQKAKLTPAQLAEFFAAGYDRQNAIDVILGVSLAT
    LCNYVNNLAETPINPELQDFA

    >gi|152978388|ref|YP_001344017.1| periplasmic protein thiol--disulphide oxidoreductase DsbE [Actinobacillus succinogenes 130Z]
    MKKKIILFLPLVVILTICALLFVGLRQDPKKIASALIDKPVPEFFQADLQHPEQIVSNKSLPKTAHLINIWGSWCYYCKQ
    EHALLLELAKQGVQIVGLNYRDKRQNALEYLQHSGNPFLFNIDDSRGKLAMQLGVDGAPETYVVDKYGVIRYRQSGALDR
    KIIEKVLLPELETLK

    >gi|152978415|ref|YP_001344044.1| putative mercuric transport protein [Actinobacillus succinogenes 130Z]
    MNSPQKSSNRTFWAICATAVSAAVASTLCCIAPLIYLVFGISSGWLVSLNELAFLQIPMLMISLGAFGYGFWLLNFSNKI
    ICTKYLSRRTLQILYWIMAIVILFFLTYPYVLPYILELTE

    >gi|152978433|ref|YP_001344062.1| hypothetical protein Asuc_0755 [Actinobacillus succinogenes 130Z]
    MRYVIAVSRPVYGHQGAFTAYQFAVALLAAGHEITQIFFFQDGVTNGNACVYPATDEFNLPKAWQKLSRDYGIPLHLCVS
    AGQRRGIVDNLTALNSELTNLADGFVIAGLGEFIRAILESERVITL

    >gi|152978481|ref|YP_001344110.1| arsenate reductase and related [Actinobacillus succinogenes 130Z]
    MMIVYGIKNCDTVKKALKWLTEHGIEYRLHDYRTEGLEPDFLARAEAQFGWQALVNKRSTTWRNLDENTKKTLDKPTALR
    VLTEHPTLIKRPIILQDDIALIGFDVKAYKQAFRL

    >gi|152978497|ref|YP_001344126.1| UDP-galactopyranose mutase [Actinobacillus succinogenes 130Z]
    MKKYDYLIVGAGLFGSIFAHEATKRGKKCLVIEKRDHIGGNCYTQNIEGINVHKYGAHIFHTSNKVVWDYIQQFAEFNRF
    TNSPVARYKDELYSLPFNMLTFNKMWGVITPQEAEAKIKAQIAQENITDPQNLEEQAISLVGRDIYEKLIKGYTEKQWGR
    KCTELPAFIIKRLPVRYTYDNNYFYDTYQGIPIGGYTAIFERMLDGIEVKLGVDFFAEREHYENLAEKIVFTGMIDEYFG
    YQFGKLEYRSLRFDNEVLDMPNYQGNAVVNYTEAEVPYTRIIEHKHFEYGTQSKTVITREHSKEYEEGDEPYYPINDGRN
    NELYAKYKALADEKSNVIFGGRLAQYKYFDMHNIIAEALECVKVHFS

    >gi|152978525|ref|YP_001344154.1| periplasmic protein thiol--disulphide oxidoreductase DsbE [Actinobacillus succinogenes 130Z]
    MNKKLFLPLIIFLGLIVAFVVQLQRNAQGDDPKALESALVGKPIPISQMTDLFENKPLGNEIFQQGKPVLVNVWATWCPT
    CYAEHQYLNELAKQDVIIIGIDYKDQSDKAVKWLKDLDNPYQVVIKDEKGALGLDLGVYGAPETFVVDGKGVVRYRYAGD
    INEKVWLQTLKPLYDKLAEEK

    >gi|152978542|ref|YP_001344171.1| iron-sulfur cluster assembly protein IscA [Actinobacillus succinogenes 130Z]
    MAITLSETALNRVRTFLQNRGSGIGLRLGVKTSGCSGLAYVLEFVDQLSDEDQIFQQDDVKIIVDKKSLVYLDGTQLDFV
    KEGLNEGFKFTNPNIKDQCGCGESFSV

    >gi|152978618|ref|YP_001344247.1| dihydrolipoamide dehydrogenase [Actinobacillus succinogenes 130Z]
    MSKEIKTQVVVLGAGPAGYSAAFRCADLGLETVLVERYSTLGGVCLNVGCIPSKALLHVAKVIEDAKHVEHHGVVFGEPT
    IDLDKIRAGKDGVVGRLTGGLAGMAKMRKVTVVEGLAKFADSHTLVATDREGNATTIKFDNAIIAAGSRPIQLPFIPHED
    PRVWDSTDALALREVPKKLLVMGGGIIGLEMGTVYSALGSQIDVVEMFDQVIPAADKDIVKIFTKRIENKFNLLLETKVT
    AVEAKEDGIHVSMEGKAANETRVYDAVLVAIGRTPNGKLIDAEKAGVEVDERGFIRTDKQMRTNVPHIYAIGDIVGQPML
    AHKGVHEGHVAAEVIAGKKHYFDPKVIPSIAYTEPEVAWVGKTEKECKAENLNYEVATFPWAASGRAIASDCADGMTKLI
    FDKESHRILGGAIVGTNAGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEVFEGSVTDLPNAKAKKK

    >gi|152978702|ref|YP_001344331.1| iron-sulfur cluster insertion protein ErpA [Actinobacillus succinogenes 130Z]
    MTDISVPLTFTDAAANKVKSLITDEENPNLKLRVYITGGGCSGFQYGFTFDEKVNEGDLTVENAGVQLVIDPMSLQYLIG
    GTVDYTEGLEGSRFVVQNPNASSTCGCGSSFSI

    >gi|152978706|ref|YP_001344335.1| copper-translocating P-type ATPase [Actinobacillus succinogenes 130Z]
    MITEKSQENGMTTILALGDLSCGHCIKAVKTALEKINGVETAEVTLHFAKVAGDVAPDILIKAVADAGYQAKPVEPDFTL
    ALNGLN
    CGHCIKSTEKALSAVENVEVFDVSKTMAKIYGAADPQTAIRAIVEAGFAASLENIPQKSEKVAIDEVKIDRRPK
    PEQPSQLAETAESVTVALSSEAAFSGEQTTLLLSGLS
    CAACVLKVERALQAVPNVQTARVNLAEQTAFVTGNVSPESLID
    AVIQAGYGAELIEDEKKRRDKQRLQTEHEIRQRKWQAIVALIMGFGLLFWGLAGGQMQVTAENRNNWIWIGIISLIVMFF
    TGGHFYQRALKSFTNKTATMDTLVALGTGAAWLYSMTVTLAPDFFPETAHHLYFESSTMIIGLINVGKMLEAKAKQRSSK
    ALERLLDLTPKTALIVEEAGEREIPLTRVQRGMTLRLKTGNRVSVDGIITRGEAWLDESMLTGEPLPVHKQEGDRISAGT
    LVTDGSVLFQAEQVGNKTTLANIIRLVRQAQSSKPQIGQLADRIAAVFVPIVIAIAFISAVIWYAVTKEISYSFVVLTTV
    LIIACPCALGLATPMSIIAGVGRAAELGVLVRDADALQKAADADTVVFDKTGTLTKGEPKVTALYTFNGFNSQSAVQFAA
    DLEQGSNHPLAKAVIAYASDLQISPQAVTDFRTLNGLGVTATVHNKSVLLGNRALLEQHSIVIAEAESLFRQESEKGATV
    VFLAAERRLAAMFVIRDPLRDDTVAALSRLHRQGYRLVMLTGDQEKTAQAIAQEAGIDQVIAGVLPEGKAQAIQQLQGQG
    KKIVMVGDGINDAPALAQANVGIAMGSGSDVAIETAELTLMRHSIHGVADALSLSKGTLRNMKQNLFFAFIYNSLGIPLA
    AGIFYPFLGVLLNPMVGGAAMACSSITVATNANRLLKFMPEA

    >gi|152978714|ref|YP_001344343.1| glutaredoxin 1 [Actinobacillus succinogenes 130Z]
    MFTVIFGRPGCPYCVRAKNLAEKLKNEVADFDYRYVDIHAEGITKEDLSKSVGKPVETVPQIFIDEKPIGGCTDFEALMK
    EKFGIVA

    >gi|152978721|ref|YP_001344350.1| glutaredoxin-like protein [Actinobacillus succinogenes 130Z]
    METLDKIKKQIAENPILIYMKGSPKLPACGFSARAVEALMNCQVPFGYVDILQHADIRAELPKFANWPTFPQLWVEGELV
    GGCDIVLEMFQVGELQTLLKEVAERHSA

    >gi|152978806|ref|YP_001344435.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Actinobacillus succinogenes 130Z]
    MVLVTRQAPDFTSAAVLGNGEIVENFNFKQHIAGKPAVIFFYPLDFTFVCPSELIAFDHRYAEFQKRGVEVVGVSIDSQY
    SHNAWRNTPVDQGGIGPVKYALAADTKHEIAKAYGIEHPEAGVALRASFLIDANGVVRHQVVNDLPLGRNIDEMLRMVDA
    LQFHEEHGEVCPAQWEKGKEGMKDNPEGVAKYLKQNADQL

    >gi|152978816|ref|YP_001344445.1| thiol:disulfide interchange protein precursor [Actinobacillus succinogenes 130Z]
    MKRLFLFLTLILIALSAQAGLFGSAESRFLRADDAFRFSTQQQGDELTLNWRIADDYYLYRKEIRLQGKHVDVGAADFPQ
    GEMHQDEFFGETEIYLNRLTLTVPLRNMADDAEIEVTYQGCTKGFCYPPETRTVALMAPTGKRSADAQSAVKKTDENPTA
    LSNAASEQDRLAARLFRSKYAVFWFFLLGLGLAFTPCVLPMLPLLSAVVIGQGARPNTWRAFTLSVVYVQGMALTYTLLG
    LLVAAIGLPFQVALQSPPVLITLSVLFVLLAASMFGAFNLQLPASWQTKLTQISQNQQSGAFGGVFVMGMLAGLVASPCT
    TAPLSGALLYVAQSGDLLTGAVTLYLLALGMGVPLILITLFGNKILPKSGAWMNRVKELFGFVLLLLPVILLERVFPAWS
    ASLWAVWAIAFCCWLASKYYWLGLLVSLAAFFAVHGIHHTDSAESAVEKSAVFQPHFSRIHSYNELQRALTANPKAVAML
    DLYADW
    CVACKEFEKYTFPAPAVRQAFEHVLLLRADMTKNSAENMELMKRLNVMGLPTIIFFDQKGKEIQSARVTGFMQA
    QPFADWVNGLTK

    >gi|152978851|ref|YP_001344480.1| DsrE family protein [Actinobacillus succinogenes 130Z]
    MQKLLFIIHAAPYGNESFFSGLRLALQIQEQHKSAVDLKLFLMSDAVAGGLAKQNPAEGYHIQQMLEILTTQGAAVKLCK
    TCTDSRGMTDLALADGVEIGTLVELADWSVEADKVFNF

    >gi|152978967|ref|YP_001344596.1| rhodanese domain-containing protein [Actinobacillus succinogenes 130Z]
    MKKLTLTLLAALVWASPMISVAAETERAVERSEQARAIWIDVRTPEEFAEGHIEGAVNLPFDQIGARIHEVTADKNAPIH
    LY
    CRSGRRSGLALETLKAQGYTNLVNRGGYRDLLVQNIR

    >gi|152978987|ref|YP_001344616.1| DSBA oxidoreductase [Actinobacillus succinogenes 130Z]
    MKIKIWSDYACPFCYVGKRHLEAALRQFAHAENVEIVYKAFELDPTAPAIVTATTQQRIERKYGRTPAGAMEFIRNVEAA
    GKRAGLEIHYVQNTNTFDAHRLTKLAETLGKADEINERLMKAYFTENLALANRENLVKCAEDAGINREQVENLLNSDRFA
    QSARNDEHQARQIGIQGVPFFVIDGKIGLSGAQPADYMLQALNQAWNEQTESEITAGIACGIDGCN

    >gi|152978994|ref|YP_001344623.1| glutaredoxin 2 [Actinobacillus succinogenes 130Z]
    MKLYVYDHCPYCVRVRMIFGLKNVPVEQIVLANDDEETPIKLVGKKVVPILLKDDGEAMPESLDIVKYTDEHFGSKILDE
    SVRPELEVWMKRVGGYYNHLLLPRFVQLGLAEFATQSAIDYFTKKKTEFIGDFAENLADSQQYIERLNQDLPELSQLLKA
    EDKANGVQVSLEDIMLFPMLRNLTCVNGLVWLPNIQRYVEQMSALSRVPLYTNRAI

    >gi|152979043|ref|YP_001344672.1| molybdopterin biosynthesis protein MoeB [Actinobacillus succinogenes 130Z]
    MAELSYQEELRYNRQIILKAIDFDGQEKLKDSRMLIVGLGGLGCAAGQYLTAAGVGHLTLLDFDTVALSNLQRQVLHNDS
    RLDMAKVESARISLKSLNPHIEINTINGLLSEEKLAEIVPHFDVILDCTDNIDIRNQLDRCCEQAKIPLVSGAAIRFEGQ
    ISVFTYEPHTPTYRQLSNLFGDSTLS
    CVEAGVISPIVGVIGSLQALEAIKVRLKIGTNLCGRLLMIDGLNMAIREIKLPT
    ETN

    >gi|152979175|ref|YP_001344804.1| TrxA protein [Actinobacillus succinogenes 130Z]
    MMKFWRYSLLLLLIPSAFAKNAADSFGVGKLRFKEGKDYFSYSSPIKTDERTDNKILVQSFFDYDCRNCSDVQDVLELYA
    QLNSNQVMVKNYPIALPKAQFSARTFYSLKAVGREDVSDSLLLETSDKHMYNKLSKMNNLLRWLEKKGVDGRTFKEMYDS
    PEISAALNDMVDMTEKYGVFTYPFVVIQGKYALTNSTLYNDDYTFAVMDYLVKQLTREKAE

    >gi|152979177|ref|YP_001344806.1| DsbG protein [Actinobacillus succinogenes 130Z]
    MGKISLFLTALSAAALSVNVMADDSVIQQNLKKLGATRIEIKPSPIKGVKAVDTEEGILYVSEDGKYVLQGKLFELTDKG
    PVDMTAKSLMGTVESYKNSMIVYPAKQEKHVVTVFFDTS
    CVYCHKMHEQIKEYNDLGITVRYLAFPRGGMDENAHRMEAV
    FTAQDKVQAFNDAENGNYPKQLKMPDVVKKHYELGVKMGVRGTPSIVTANGELIGGYLPPAQLLAVLEG

    >gi|152979250|ref|YP_001344879.1| thioredoxin reductase [Actinobacillus succinogenes 130Z]
    MSDVKHSKLLILGSGPAGYTAAIYAARANLKPVLVTGLQQGGQLTTTTEIENWPGDFGDTTGPELMQRMLQHAEKFETEI
    VFDHINSVDLSSRPFKLYGDEQTFSCDALIIATGASARYIGLESEENFKGRGVSA
    CATCDGFFYRNKPVAVVGGGNTAVE
    EALYLANIAGEVHLIHRREGFRAEKILLGRLQKKVEEGKIILHTNRTLDEVLGDNMGVTGVRLQDTQSDATEELKLDGVF
    IAIGHAPNTEIFQGQLELNNGYIVVKSGLEGNATATSVEGVFAAGDVMDHNYRQAITSAGTGCMAALDAERFLDAQE

    >gi|152979306|ref|YP_001344935.1| OsmC family protein [Actinobacillus succinogenes 130Z]
    MKIFYHTSATATGGRDGRTQVDDGSIGFDLVGFQNESGKVGTNPEQLFAMGYAACFDNAIIHIAPTLGIKPTKHSTTVGV
    GIGQKPGGAFSFEIDITITVEGISAEEAKTLIEKAHET
    CPYSNATRGNVDVRLHVNVIQTIDL

    >gi|152979327|ref|YP_001344956.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Actinobacillus succinogenes 130Z]
    MRIKSLFPVLSAVVFSAILFGCKEQTAEIGKQAPDIAVFDLQGNKTELNQFHGKTLLMSFWSGNCGVCVAELKSLEKMAA
    EYPDKVEILAINIDGENADTQAVVIKQKIGLPVLKDQMKITGERYGVTGTPTSFVISPEGNIQAKYEGLIPEQTLQKLFK
    G

    >gi|152979393|ref|YP_001345022.1| Na(+)-translocating NADH-quinone reductase subunit E [Actinobacillus succinogenes 130Z]
    MEYILLIVSTALINNFVLVKFLGLCPFMGVSKKVETAVGMGLATMFVLTVASLCSYLVNTYLLIPLKAEFLRTLVFILVI
    AVVVQFTEMAINKTSPTLYRLLGIFLPLITTN
    CAVLGVALLNVNLTHNLTQSVVYGFGASLGFAFVLILFAALRERLAAA
    DVPVPFRGASIALITAGLMSLAFMGFAGLVRA

    >gi|152979394|ref|YP_001345023.1| electron transport complex protein RnfB [Actinobacillus succinogenes 130Z]
    MMMYILLAVAALALIFGVILGLASVKLKVEADPLAEKIDAVLPQSQCGQCGYPGCKPYAEAIVNGDEITKCIPGGQPTVV
    KIAEILGVDVPTMDGVSEPEIKVAFIHEDMCIGCTKCVQACPVDAIIGTNKTLHTVIPELCTGCELCVAPCPTDCITMEK
    VEPKIENWDWKSAPNIIPVKNAAEGKPND

    >gi|152979398|ref|YP_001345027.1| SoxR-reducing system protein RsxE [Actinobacillus succinogenes 130Z]
    MTEQTNQNFWRELFAQGLWRNNPAIVQLLGLCPLLAVSNSATNALGLGLATLLVLTCTNTVVSLLRRQIPHEIRIPVYVL
    IIATTVTAVQLLMNAYTYSLYQSLGIFIPLIVTN
    CIVIGRAEAFASQNGVLHSAFDGFAMGLGMTLSLFLLGALREILGN
    GTLFDGLHLLLGDWAKMFRIEFFHHDSNLLLAILPPGAFIGLGIILAAKNIWDKYRA

    >gi|152979407|ref|YP_001345036.1| selenide, water dikinase [Actinobacillus succinogenes 130Z]
    MRKIKMTENLTALQQALDSTVTDTIRLTQYSHGAGCGCKISPKVLGTILQTKLEQFIDPHLLVGNDTADDAAVYDIGNGV
    GIISTTDFFMPIVDDPFDFGRIAATNAISDIFAMGGKPIMAIAILGFPIKLLPAEVAQRIVDGGRFACKQAGIALAGGHS
    IDAPEPIFGLAVTGMINTDKVKKNASAQAGCKLYLTKPLGIGVLTTAEKKGKLKAEHQNLATQVMCQMNLVGSAFSEIDG
    VTAMTDVTGFGLLGHLIELCEGSQLNAVVYMDKIHTLDGVRDYLEKGCVPGGTMRNFDSYGNKVSTMTEIQKAILCDPQT
    SGGLLVAVRPDSAEALLNVARQADVEIFEVGELLSPQEGEIVVTVK

    >gi|152979502|ref|YP_001345131.1| thioredoxin [Actinobacillus succinogenes 130Z]
    MAEVFHSTDASFEADVLKADVPVLLDFWAPWCGPCRMVGPILEELAAEYGDKVKIVKINIDENQGTPAQFGVRSIPTLLL
    FKDGKVVGTQVGALPKNQLANFVNQAL

    >gi|152979542|ref|YP_001345171.1| disulphide bond formation protein DsbB [Actinobacillus succinogenes 130Z]
    MFGYLKRISIERSSWLLLFVSAICLELAALYFQYGLKLDPCVMCVYERVALFGVVFAGIIGFIAPQFLIFRLLALAVGLW
    GAIKGLLFSIKHVGYQLHPNPWDQ
    CPVFVQFPETLPLDKWLPALFHPTGLCSEINWTFMGFTMPQWLIFIFGFYAVALGL
    ILLSQLKKSAVRNRNIFR

    >gi|152979559|ref|YP_001345188.1| methylated-DNA--protein-cysteine methyltransferase [Actinobacillus succinogenes 130Z]
    MKPIYYCYFSSPVGCLLLLEQEGRLTNLDCEAEQTTPNPKWILDENRPLFDDVKAALTRYFQGEKETFAQIPLAPQGTEF
    QQSVWTALRTIPLGETATYGSVAQAIDNPKAVRAVGGAVGSNPISIIIP
    CHRVLGKNRQLTGFGGGLPVKRFLLNLEGIG
    YVDKGVEYVKQKLLKKYKI

    >gi|152979676|ref|YP_001345305.1| glutathione reductase [Actinobacillus succinogenes 130Z]
    MTKHYDYLSIGGGSGGIASINRAASYGKKCAVIEAKYLGGTCVNVGCVPKKVMFYGAQIAEAIHHYAPDYGFDVTVNQFD
    FAKLVESRQAYIGRIHTSYNNVLAKNNVDVLNGFAKFVDAKTVEVTYADGSSEQVTADHILIATGGRPTIPAVKGAEYGI
    DSNGVFALKALPKRVAVVGAGYIAVELAGVFNSFNVETHLFVRKHAPLRNQDPMIVETLLEVLEQDGIRLHTQAIPQEVV
    KNTDGSLTLKLEDGRETTVDSVVWAIGREPATDVINLQAAGVETNARGFVKVDKYQNTTVKGIYAVGDIIEGGIELTPVA
    VAAGRRLSERLFNNKPDEHLDYNLVPTVVFSHPPIGTVGLSEPKAIEQYGAEKVKVYKSSFTPMYSAVTQHRQPCSMKLV
    CVGADEKVVGLHGIGFGVDEMIQGFAVAIKMGATKADLDNTVAIHPTGSEEFVTMR

    >gi|152979730|ref|YP_001345359.1| DSBA oxidoreductase [Actinobacillus succinogenes 130Z]
    MKIQIWSDYACPYCYIGKRHLEQALEQFAHKDEVQVEFKAFELYPQAGTTAVNTTQERIEKKYAKSPQGALEMIAHIENM
    GKRAGLAMNYAGVKNTNTFDAHRLYKWADALGKGGEMNERLMEAYFSDNVELANHDNLAKFAEDVGLNGEEARKMLADND
    FAQAVKDDENEARTIGVQGVPFFVFDGKTATSGAMPVGGLVQLLNQVYAENHQDGLNGASCGIDGGE