Chlamydia trachomatis 434 Bu

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|166154122|ref|YP_001654240.1| protein disulfide isomerase [Chlamydia trachomatis 434/Bu]
    MRNWLLGSLLIACMAVTAPCFAAKRRAAGSQKINRVAETGIHWMSYQDALNKAKQEGKHVAVFFTGSDWCIWCMRMQDQI
    LQTAAFSEFAKQYLCMVEIDFPHNKEQTAEQKEQNRHLKSLYSVDGFPTLVFLDSEGKEVAKMGFEPGGGEAYVYRLKQA
    LHIS

    >gi|166154320|ref|YP_001654438.1| thioredoxin reductase [Chlamydia trachomatis 434/Bu]
    MNVVCGKSRVGYSSFFCKSREPFSCVFKALLSKFILGVLMTHAKLVIIGSGPAGYTAAIYASRALLTPVLFEGFFSGIAG
    GQLMTTTEVENFPGFPEGVLGHQLMDLMKTQAQRFGTQVLSKDITAVDFSVRPFVLKSGEETFTCDACIIATGASAKRLS
    IPGAGDNEFWQKGVTA
    CAVCDGASPIFRDKDLFVVGGGDSALEEAMFLTRYGKRVFVVHRRDTLRASKVMVNKAQANEKI
    FFLWNSEIVKISGDTLVRSIDIYNNVDKTTTTMEAAGVFFAIGHQPNTAFLGGQVALDENGYIITEKGSSRTSVPGVFAA
    GDVQDKYYRQAITSAGSGCMAALDVERFLEN

    >gi|166154387|ref|YP_001654505.1| disulfide bond chaperone [Chlamydia trachomatis 434/Bu]
    MDTRTPLRKKILIISTALGFVLCVGLMIHTKRSIMPPKTHIPTTAKYFPTIGDPYAPINITVFEEPSCSACEEFSSEVFP
    LIKKHFVDTGEASLTLVPVCFIRGSMPAAQALLCVYHHDPKRPDPEAYMEYFHRILTYKKTKGSHWATPEVLAKLAEKIP
    THSGREINPKGLIQCINSQRFTEQLKKNNIYGSQIMGGQLATPTAVVGDYLIEDPTFDEIERVITQLRHLQAIEEEVR

    >gi|166154491|ref|YP_001654609.1| Na(+)-translocating NADH-quinone reductase subunit D [Chlamydia trachomatis 434/Bu]
    MTTNKSYLTYFTDALWINNQPLIAILGICSALAVTTTVTTALTMGFAVSFVTGCSSFVVSLLRKITPESVRMIAQLIIIS
    LFVILIDQFLKAFFFTISKTLSVFVGLIITN
    CIVMGRAESMARHVSPIPAFLDGLGSGLGYGWVLVCISIIRELFGFGTI
    LGFRVIPEILYASAAHPDGYENLGLMVLAPSAFFLLGIMIWIVNIIRAPKTKR

    >gi|166154492|ref|YP_001654610.1| Na(+)-translocating NADH-quinone reductase subunit E [Chlamydia trachomatis 434/Bu]
    MWLGDYSLLNLLGIFLQATFIQNILLSTFLGMCSYLACSSRLSTANGLGMSVALVLTITGSINWLVHYFITKPGALAWLS
    PALANIDLSFLELIMFIVVIAAFTQILELLLERFSRNLYLALGIFLPLIAVN
    CAILGGVLFGITRNYPFLPMVVFSLGSG
    CGWWLAIVLFATIREKLAYSDVPQHLRGTGISFITTGLMAMAFMGLTGIDISKPTTSKPAFVMNIATDSPQPNTHSSSEE
    PKAS

    >gi|166154691|ref|YP_001654809.1| putative DNA methyltransferase [Chlamydia trachomatis 434/Bu]
    MAEKFFVVSPTSKNCLAQACSQGLPINRTPPIQIIVHFRGDSIFHSRLSPAPVFTCLFLGPGAHKAMEGLVRWCEAYANK
    MPPKLSFLDLSSFKEKRLAILQEIRQIPFGTRHTCEEIAERTKTHTEEVLIACQENPLPLLIP
    CHRVLSIHDYPGGEKLY
    KALTEFEELS

    >gi|166154754|ref|YP_001654872.1| thioredoxin [Chlamydia trachomatis 434/Bu]
    MVQVVSQENFADSIASGLVLIDFFAEWCGPCKMLTPVLEALAAELPHVTILKVDIDSSPRPAEQYSVSSIPTLILFKDGK
    EVERSVGLKDKDSLIKLISKHQ

    >gi|166154772|ref|YP_001654890.1| dihydrolipoamide dehydrogenase [Chlamydia trachomatis 434/Bu]
    MNEAFDCVVIGAGPGGYVAAITAAQAGLKTALIEKREAGGTCLNRGCIPSKALLAGAEVVTQIRHADQFGIHVEGFSINY
    PAMVQRKDSVVRSIRDGLNGLIRSNKITVFSGRGSLISSTEVKILGENPSVIKAHSIILATGSEPRAFPGIPFSAESPRI
    L
    CSTGVLNLKEIPQKMAIIGGGVIGCEFASLFHTLGSEVSVIEASSQILALNNPDISKTMFDKFTRQGLRFVLEASVSNI
    EDIGDRVRLTINGNVEEYDYVLVSIGRRLNTENIGLDKAGVICDERGVIPTDATMRTNVPNIYAIGDITGKWQLAHVASH
    QGIIAARNIGGHKEEIDYSAVPSVIFTFPEVASVGLSPTAAQQQKIPVKVTKFPFRAIGKAVAMGEADGFAAIISHETTQ
    QILGAYVIGPHASSLISEITLAVRNELTLPCIYETIHAHPTLAEVWAESALLAVDTPLHMPPAKK

    >gi|166154809|ref|YP_001654927.1| thiol:disulfide interchange protein [Chlamydia trachomatis 434/Bu]
    MIRQWYGFFLCLLFSYTSCFGVEENSGRATPTVELVSESEQAVEGEVLRIGVLIAIPEGEHIYWKNPGKLGMPLRISWDL
    PSGCRLLEEHWPTPEIFEEDGVVYFGYKHSTMVVADIRVSKEIETRPLEIKAQVEWLSCGASCLPGSSSRVLVIPIDQGP
    LIPNSKETFTFSRALAAQPRPLDAAIKISYQPDGLDVLVPAGKADRATQAWFIAENTRDFAYAQEVPLEQATTYIWKLKH
    PEGNMPKGVGLSGILIFKDDAGKVVASYQVEENQVEQLSALSWGFLSILLMAFIGGILLNIMPCVLPLITLKVFSLIKSA
    ADHHSSSVIGGIWFTLGAIVSFWGLAFCAFLLKVLGQNIGWGFQLQEPMFVAVLIIVFFLFALSSLGVFEMGMICLSLGE
    KLQEEGGASVRKNQIWGAFFNGMLTTLVTTPCTGPFLGSVFGLVMAVSFVKQLAIFTAIGLGMASPYLLFASFPKMLAIL
    PKPGPWMSTFKQLTGFMLLATATWLIWIFGVETSATAVTILLVGLWLAAVGAWILGRWGTLVSPRNQRLLASVVFIFCIL
    SSLVITSIGVRYFDENVPPAHSFDWQSFSPEKLADLREKGIPVFVNFTAKW
    CLTCQLNKPLLHANMQAFAAKGVVTLEAD
    WTKKDPKITEELARLGRASVPSYVYYPAGNKAPLILPERLSQSALEEMVFSQ

    >gi|166154817|ref|YP_001654935.1| thioredoxin peroxidase [Chlamydia trachomatis 434/Bu]
    MGSLVGRQAPDFSGKAVVCGEEKEISLADFRGKYVVLFFYPKDFTYVCPTELHAFQDRLVDFEEHGAVVLGCSVDDIETH
    SRWLTVARDAGGIEGTEYPLLADPSFKISEAFGVLNPEGSLALRATFLIDKHGVIRHAVINDLPLGRSIDEELRILDSLI
    FFENHGMVCPANWRSGERGMVPSEEGLKEYFQTMD

    >gi|166154842|ref|YP_001654960.1| hypothetical protein CTL0891 [Chlamydia trachomatis 434/Bu]
    MEKNYYALAYYYFGPVSNPYEEIALHKQLFKTMDVSCRIYISEEGINGQFSGYQPDAERYMAWLKQRPDFASIKFKIHHI
    EENIFPRVTVKYRKELVALGCSVDTTKQGKHISPEEWHEKLQENRCLVLDVRNNYEWKIGHFENAVLPDIETFREFPDYA
    DRLAKEHDPAKTPVMMY
    CTGGIRCELYSALLLEKGFKEVYQLDGGVIAYGLKMGTGKWRGKLFVFDDRMAMPIDEADPNV
    SPIARCSLCNTDSDTYYNCANTDCNNLFICCESCIATHKGCCSEECSQAPRIRAFSAERGNKPFRRKHLCPTIEQSCCLK
    EQENQPA