Chitinophaga pinensis DSM 2588 uid59113

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|256419087|ref|YP_003119740.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chitinophaga pinensis DSM 2588]
    MRVLFVALLLIGIFSCERQRPLPPGIGRKMPDFKIQLLDTAVKINTASIPKGKPVVLFFFGPDCPYCQALTRELTKRMDE
    LKDTRFYFVTVADFKEIQMYDTLFKLDKFQNVTIGKDVDGFFFSYYKAPGFPYLAVYNKKKEFREIIIGGINVDSLKKVI
    RS

    >gi|256419152|ref|YP_003119805.1| peptide methionine sulfoxide reductase [Chitinophaga pinensis DSM 2588]
    MSIQTAILAGGCFWGVEELIRALPGVSKTIVGYTGGDVPNATYRNHGSHAEGIKIEFDPNVLSYRKLLEFFFQIHDPTTR
    NRQGNDIGTSYRSAIFYLDEAQQQTAVELIKELNAAGIYKHPIVTEVVPAADFWDAEEEHQNYLQKHPFGYTCHFIRPEW
    QLATSEGK

    >gi|256419262|ref|YP_003119915.1| UBA/THIF-type NAD/FAD binding protein [Chitinophaga pinensis DSM 2588]
    MMQRYDRHLKLDGFGPAKQQLLSNAAVLIIGAGGLGVPVLQYLTAMGVGRIGIVEHDDISLTNLQRQVLYNTDEVGQPKL
    RTAVQRLKKLNPEVQFSTYDTWIMPDNALDIIQPYDVVVDCTDNFGTRYLVNDACVMLNKPFVYGAIHKYEGQVSVFNYK
    GGATYRCLFPEQPEPGTMLN
    CSDIGVLGILPGIIGSYQANETVKIVTGIGEVLSNQLLTIDTLYNMHDTFQIKPVAGNHD
    IKALQETYDQPCDTGGVRSLSVHQLQDWLDTEKPLQLIDVREPDEWEICSIPQAMRIPMRMVGGVMAQLSKEIPVALL
    CH
    HGMRSLMVAQQLDAAGFPAVYNVEGGIHAWAAEIDVEMNRY

    >gi|256419305|ref|YP_003119958.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chitinophaga pinensis DSM 2588]
    MKKHFFYLLFFCIAASLQGYSGIGPTQPPIDTLLDIPAPRFSMLDTNGKTVSLSDFKNKVLVVYFWSTWCYYCHKDFPMI
    NKVVKQYANDTTVAFLFVDTREKSDQYKELVQKDMVKNNYNFHVVFDEKGKDSLQNKYYTQFGTIGIPTRFVIDRNMVIR
    HKFVGYDPDVNEEQAAAAFSRSIEDTKKLASHNKP

    >gi|256419399|ref|YP_003120052.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chitinophaga pinensis DSM 2588]
    MNTIARIGVKGLLATVLFGSTVFATEKKPLFLKEGVWRGVFTVNEANVPFNFEFKGKDPEHSVFSLINGTRRDEFKVKRV
    GDDSLFIKMNTYDAALFAKIESDGRITGEYRSLVPNFRGNALPFVAEAGKKYRFVEPGKDVKPAVNLSGKWELQIYSKEP
    TPNRIGLLKQDGNRLTGVIMSVVGDSRELEGTVQGNEFELSGFTGPSPIYIKGHINDDQSFTGELSLGIYNNVKFDGNKN
    ANAELPDPYKLTYLKEGYKKLDFTLPDLNGKQVSLSDAKYKDKVVIVEIIGTW
    CPNCTDQTAFLAPWFKKNKDRGVEAIA
    IGFEQKDDLEYARYTLGKLKDKYGIEYDILFGGIADKKVASEKLPALNRMMAFPTTIIIDRNGDVRQIHTGYTGEITGNY
    FNDYVKKWNDDLDALIAEPVRQDVAIK

    >gi|256419428|ref|YP_003120081.1| OsmC family protein [Chitinophaga pinensis DSM 2588]
    MKRTASANWKGTGKDGKGTVSSQSGVLDNTAYSYKSRFEDGTGTNPEELIAAAHSGCFTMKLSFLLSGAGFTPENIDTKA
    TITLENGAITSSHLELKATVPGLDNAKFLELAEEARTN
    CPISKLLNTEITLDAQLA

    >gi|256419498|ref|YP_003120151.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chitinophaga pinensis DSM 2588]
    MKKLALWAATGLFLASCSQQTEKGDFTINAHIDNAPLGTIYLEELTTEEVKIVDTAVIKDASGKFTLKGMLPEQALYRIR
    FGETNRLIPLGLDAGTMSITGDFNHLGELKIENSEATVEIQQLLNEASAKDQALSAEMTALDSLHQLKTPDSVLQPRVAA
    FQAKQEDFKKFLVKSATETKSPAVAAFAMSIAGPQVLMEDPKTVEEIKKHFPENTLIVSFADKLKQGAQQNEETGEEANM
    STVKIGQAAPDFTLPDPSGKPVSLSSFKGKYVLVDFWASW
    CKPCRMENPNVVLAYNKFKGKNFTVLGVSLDKTKGKWEEA
    IQADGLTWTHVSDLKFWDSQVVPLYGINSIPSNMLLDPQGKVLAIGLRGPALESKLQEVLQ

    >gi|256419531|ref|YP_003120184.1| protein of unknown function DUF255 [Chitinophaga pinensis DSM 2588]
    MNRLAKETSPYLLQHAHNPVDWYPWGEEALQRAKTEDKPILVSIGYAACHWCHVMERESFEHEETARIMNEHFINIKIDR
    EERPDLDHIYMDAVQAMTGSGGWPLNVFLTPDKLPFYGGTYFPPVKAFNRPSWTDVLLALSQAFKERREDLETQAQNMRD
    HLVQASGFSGKAPGQDLVPHEELFTKAQCETIFNNMMQQGDKVWGGFGSAPKFPGTFIIQYLLRYHHSFNEPKALEQALL
    SLDKMIRGGIYDQLGGGFARYSTDAKWLAPHFEKMLYDNALLVDVLSEAYQLTGNELYARTIADTLGFVAREMTDAGGGF
    YSALDADSEGVEGKFYTWSKEEIEHILGTDAALFCAFYDVTEEGNWEETNILWVTKPAAVFAAEQGITEEALERSLAISR
    EKLMAVRAKRIRPGLDDKIILGWNALMIHACCKAYAALGIERYREMGVNAMKFCLEHLQNTDKQSFFHTFKGGVAKYPAF
    LDDYAWMVRALIALQEVSGEPEWLSKAKELTEYVVNNFSDEGGIYFYYTEAGQTDVIVRKKEVYDGATPSGNAVMAANLL
    YLSVVYDRKDWSNRGIHMLAGQSQTAVRYSTSFGVWAGVLLQQVIGVREIAVVGAEYKSRMRDTNRHYIPFKVMLGAATD
    QPGLPLLEQRERPGETLIYVCEHYHCIKPVNYIEEIINLK

    >gi|256419563|ref|YP_003120216.1| electron transport protein SCO1/SenC [Chitinophaga pinensis DSM 2588]
    MLAILVPLAGYLIVDHYSKNVVPIPRYYIPEGVDTIVKNGTTTYDTTFHVVKDITLTNQMGRQVSLKDLPNKVILVNFFF
    TS
    CPSICPRMMANLEKIQQAYIKNDTLLQLVSLTVDPERDSSETLRMYGVKHGINPDNWWLLTGAKKDIYDWARNEVYVS
    VVKGDGGPDDFIHTEKLVLLDKNHNIRGYYDGTDSNAVRKCANDIAVLHLEKDKHRPGLLKRLFSTTE

    >gi|256419725|ref|YP_003120378.1| E1-E2 ATPase-associated domain protein [Chitinophaga pinensis DSM 2588]
    MANTAVTPDTKLQCAHCGEDCPNNKIVLENNHFCCEGCKLVYEILNENGLCDYYTLNQNPGQSQRISVRKDKFAFLDDKK
    IQQQLIQFQDDSQTHITFYIPHIH
    CSSCLWLLENLHRLDTGVQRVTVNFTRKEALVVFRQDETSLRHIAETLTSIGYEPY
    ISLQDLRQKKPRIQRDLVYRLGVVGFCFGNIMLLSFPEYFSSYGYSDEKMNHLFRWLNLSLSLPVFFYSAQVFFRSAWGG
    LKTGFLNIDVPIVLAIIVTFIRSLTDVFSGQGAGYFDSMTGIVFFMLVGRILQDKTYQGLSFDRDYTAYFPIAVSVLKKG
    REVPMALPDIRNNDTLLIHNQELIPADGILVKGDAIIDYSFVTGEAVPVHKATGEIVYAGGKQLEGNIEILTIKEVAQSY
    LTSLWNREELRSPQEKQVSFIHMLSRYFTWVVLSIAVIAATYWWMHDAARIWPAVTAVLIIACPCALLLAASFTNGHILR
    ILSRRHLYLRNAEAIERLATIDHIVFDKTGTLTGKAEATISYEGETLTPEKLIAVGTLAAQSSHPLSKMIASFFGRDERL
    PVRNFRSIEANGISGWIEYNFIQLGSAAFIGADTNVSSDGSTVYVKIDGHQVGRFIIRHQYRNGIQSLLQQLQRQYHLSL
    LSGDNDAESAYLQKIMGPSASLHFAQKPADKLNYVVSLQQQGHRVLMIGDGLNDAGALKQSDVGISLTENSNNFTPASDG
    ILEAASLIHLPRLISTCRNNRRIIIITFIISLLYNFIGLFFAVQGILSPLTAAILMPASSISIVLLTYGLSEWMNRS

    >gi|256419757|ref|YP_003120410.1| arsenate reductase and related [Chitinophaga pinensis DSM 2588]
    MKKIYHLSTCTTCKRILEEVKAKENGFVLQDIKTEKITPAQLEEMHALAGTYEALFSRRSQKYRPMGLHEKELTENDYRD
    LILQEYSFLKRPVAIVGKQIFVGSDKKAVEGLTAAAAK

    >gi|256419810|ref|YP_003120463.1| Rhodanese domain protein [Chitinophaga pinensis DSM 2588]
    MSYTNFVKPAEAHALLNKPDVVFIDCSFALNDKEWGRKEYEKAHIPGALYADLDKDLSGPIIAGKTGRHPLPEKQALEAT
    IASWGITSDTQVIAYDAGAGFMAAARLWWLLRWAGHEQAAVLDGGKKVWAENGYTLDAGVVTPVAKAFTARYDDTLLADA
    AAVLKATAEHGSCVIDSRTADRYAGQNETIDPVAGHIPEAISRPFNANITPEGLVAGQDVVRGYFAADFAKDDVIFY
    CGS
    GVTAAFNVLLANYAGYAMPKLYAGSWSEWITDDSRPVAVGA

    >gi|256419868|ref|YP_003120521.1| methionine-R-sulfoxide reductase [Chitinophaga pinensis DSM 2588]
    MEDQKKSDVYSRTDTSKVNLTNEEWKERLSPEVYNIAREKGTEWAFTGKYWNSKDDGTYYCAACGNPLFVSDAKFESSCG
    WPSFFEPVTKGSLIYAPDNTHGMHRTEVMCGRCKAHLGHVFDDGPPPTGLRY
    CINSVILDFERAKEAENKFNGK

    >gi|256419909|ref|YP_003120562.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chitinophaga pinensis DSM 2588]
    MILLVCILCHWQLQAQGYQLTFQLKQYKGGQLALAHYMGKSFYMADSAQINEQGIAIMKNKEALPGGIYIVLLPGRQRYF
    EMLLDNKDQQFSISVDTSDLINKTVFKTSRENEIFQSYNKFLQKEVSTQDKQINALLAKHTAADSAAARPLQVALGKRLQ
    DFRNGVIGKYPQSLLTSIFRAMKEPEVPATPAGEDSTFGYRYYKTHYWDSVNLNDGRLVRTDIIERKLNRYFTQLVAMDP
    DSIIVEADKVVDKTRKDKEMFKFVVWWLTYTYETSKYMGMDAVFVHMVEKYYVSGEAYWLKDDQLNKIISRAYSMAPNLI
    GQQAPPLEVKDTALQAISLYTTKAKYTVLVFWDPT
    CGHCKIELPRLDSAYNANWKNKGVAMIGFKTEGTKDEWQGFIKEH
    HLTGWIHAWDPDAQSNYRRLYDVYSTPVVYLLDEKKKILAKRLGVEQLNDFLEKLESKGGTVHK

    >gi|256419922|ref|YP_003120575.1| Peroxiredoxin [Chitinophaga pinensis DSM 2588]
    MTMLKTLLISMLLFMKGGAIYDYKVESVDGGKINFADYKGKKILIVNTASMCGNTPQYAELEKLYKKYEKNLVIIGFPAN
    NFGQQEPGSNAEIKEFCTKKYAVSFPMAAKISVKGTDIHPLYKWLAEESKTKHFEPAEVQWNFQKYLLDEKGNLVAVFSP
    KTQPLSPEVTAAIEKKY

    >gi|256419992|ref|YP_003120645.1| beta-lactamase domain protein [Chitinophaga pinensis DSM 2588]
    MFVKQLYTNCLSEAAYFIESEGEAVVIDPLRDIDAYLDLAKERNATIKYIFETHFHADFVSGHLDLAAATNAPIVYGPEA
    VTTFPIYLAKDGEKFTIGKLTLEVLHTPGHTLESTCYLLSDEAGNPHSIFTGDTLFVGDVGRPDLFSGNLTKEELAGYLF
    DSLNNKIKVLPDNVIVYPAHGPGSSCGKNLGPHTYSTLGDEKSTNYALKAADKDAFIQEVTSGLSTPPSYFPINARINKE
    GYDALQAVMEKSNRALSVAEVKEKLKDEILILDTRPAAEFTEGFVPGSISIGLEGRFAEWAGSLLPFGEDIILVTSPGKE
    EETIVRLARVGFDHVAGYLEGGYDAWIAAGEPRDLIITVEPDELAMDLPHDENLVIVDVRKPAEYADGHIEGAMNLTLSD
    MTDPGNLADFDDNHNLYVH
    CQGGYRSIIACSIMKREGIHNLRNVQGGYNAMKTQEGLKVVQEKNVLN

    >gi|256420078|ref|YP_003120731.1| alkylhydroperoxidase like protein, AhpD family [Chitinophaga pinensis DSM 2588]
    MADEIQAFNDYRAKMNEVILGKQNKVINRLFNLDTNTYAEGALSTKVKEMLGLVSSMVLRCDDCIKYHLGKCHEQGITTE
    EMYEIFAVANIVGGTIVIPHTRRAAEYWEALQQQEQA

    >gi|256420226|ref|YP_003120879.1| Peroxiredoxin [Chitinophaga pinensis DSM 2588]
    MTHLKEGDKAPIFKGIDQEGKQVSLTDLKGKKVILYFYPKDMTPGCTAQACNLRDNYQALLKKGFAVVGVSTDSEKRHQK
    FTEKYELPFPLLADEDRMIHTQYGVWGEKKFMGRIFDGTHRTTFLINEKGVIDKIIVKPDTKNHTEEILEIWQ

    >gi|256420247|ref|YP_003120900.1| Peroxidase [Chitinophaga pinensis DSM 2588]
    MSLRLGDTAPNFQAKTSQGDIDFYEFLGDSWGVLFSHPADYTPVCTTELGKTAQLKDDFAKRNVKVLALSVDPLEKHLGW
    INDINETQNTDVQFPIIADEDRKVSDLYDMIHPNASETFTVRSLFIIGPDKKVKLMITYPASTGRNFNEILRVIDSLQLT
    ANYSVATPANWVDGEDVIVTAAVKTEDIPGRFPKGHKIVKPYLRTTPQPNK

    >gi|256420307|ref|YP_003120960.1| heavy metal translocating P-type ATPase [Chitinophaga pinensis DSM 2588]
    METISCKVRGMHCTNCAQSVSRYLEHKGMQDVNVSFATEELSFTLPEGVTSATEVLNGINQMGYQILLPDQPLPKAAFLN
    TLSFKFIFCAIFTAPLLLHMWVNWGWLHNPYVQLALSTPVYLVGLWHFGRSAWRSLVNRLANMDVLITLGATAAYGYSLT
    GTLLHLGGEYMFYETAAAIITLVFLGNLLEERSVKQTTTAIADLARMQVTTARLITDHGNHEHIHAVDNRTLKPGDKVLV
    NTGDKIPMDGTIYWGNGYINESMITGESTPISKKEKDKVIGGTIMEDGSIKMFITATGKDTVLSYIIELVKQAQGSKPDM
    QRLADRISGIFVPLVLGISIATFLGWLLFSQVTTGEAIMKSIAVLVIACPCAMGLATPAAVMVGLGRAANNGILIKGANT
    LEAFKDIKYVVLDKTGTLTTGKLQIGNYHFEGISEQAFKATVYSLEKYSSHPIARSLSAQWKGEGEAGLLQVREIKGRGM
    QAKDTQGNEWQLGSYTMAENATKDDSHNIYLLKNGQLAGWIDFTDEIRPDAAQMVQLLKHRGIKPVLLSGDTERKCRELA
    AQVGITEVFAGQTPEQKLQKIDALMKEAAVAMVGDGINDAPALARASIGISLSDATHVAMQSANVILLNNRLSSLPLALG
    LGRHTYLTIKQNLFWAFIYNIIAIPFAAFGVLSPISGAGVMALSDIVLAVNSVRLRYKKVV

    >gi|256420310|ref|YP_003120963.1| protein of unknown function DUF1573 [Chitinophaga pinensis DSM 2588]
    MKKLALTLFVSLFFLCTQAQTNTSTATEHPADSKVKFKKENVDFGTTAFNKPVTVNFEFTNVEKQPVLIENVRTSCGCTA
    PTWTKEPVLPGKSGKVTTTYSANSVGQQNKTIWVKIKGIDQEKELHLTGTVQN

    >gi|256420396|ref|YP_003121049.1| OsmC family protein [Chitinophaga pinensis DSM 2588]
    MKRYAKAIWHGAGKDGRGHMTTESEALDKQVYSFSSRFTSEEGTNPEELLAAAHAGCFTMKLSFVLDEAGYFPEALETTA
    YVNFENGVITASRLVVTGKVWGISPDDFDVCVREAKRN
    CPVSMALNIMITTEANLQNW

    >gi|256420642|ref|YP_003121295.1| hypothetical protein Cpin_1598 [Chitinophaga pinensis DSM 2588]
    MRSILFLLLIVALGGSVHAQVLQSPDKAFAQAQASGKKIMLVFSGSDWCIPCIRFNKQILSDSSFLRFAGENLVLLEADF
    PQRKKIAAPLRQQYDSLAAAFNPEGAFPQLVLLSPQKKLLAYIPYREETPDGFITTLKHLLQ

    >gi|256420691|ref|YP_003121344.1| protein of unknown function DUF1573 [Chitinophaga pinensis DSM 2588]
    MKKFILSLFASMLLTTALWAQTQTGNPVDAKVKFKQETIDFGKTKLNKPVSVDFEFTNTTKEPVLIETARASCGCTTPTW
    TKEPILPGKKGKVTASYSANSVGQQNKTVWVRLKGVDQDKELHLTGTVEN

    >gi|256420877|ref|YP_003121530.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chitinophaga pinensis DSM 2588]
    MKRLVTGAFAVLFSFTAFAQQTVSGTLKGAEGKKVYLYSDDDNNPKDSVVLSGNKFSFKVPSTEGPRVFALILQDVNNPL
    LLVSGKESLQYTLEAQQFPIASSFKGNEENKAMQAYQQTFLALVQKAQNLNAEAAKITGDDEAGKNAFRAKASMFNEDVV
    NTGTTFIKGHPKQLASIWILLNELRGRLEPDDFQEYFNLLDKPLKESRYGQAALKYLHSVKGDVGGVAADFTQDDVNGRP
    VSLSSFRGKYVLIDFWASW
    CGPCRAENPNVVKAFERFKDKNFTILGVSLDDNKTRWMGAIKQDNLQWTQVSDLKGWGNEA
    AQMYGVRAIPANFLVDPQGNIIATNLRGSALEAKLQQILK

    >gi|256420878|ref|YP_003121531.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chitinophaga pinensis DSM 2588]
    MKSVMMAVALLAPMVLLAQEKWKGEQAFTIQGTVTALQKPAKVYLNIRRCGDNTLDSAEVKEGKFSFSGKLAEPTMANLY
    LKVLEPVLSPDAQERKSCDVLTLFLDKGNISITAEDSISHGVVKGAVANDDYNHLNELLKDVNGKLDELEKQYRQAYMAE
    DEEGMRKLEPQFDDLEAQQKQILADYLKNNSNSPIALYVLNKYADYDIDLVEIEPMFNKLGKTLRNTPSGKDFAAALDKA
    KKTAVGQPAMDFAQPDKDGKDITLASYKGKYVLLGFWASW
    CGPCRAENPNVLKAYSRFKDKGFDVVSISLDEKREKWLAA
    IQADNLAWAQVSDLRGWKNAVAEKYGIKAIPQNLLIDPNGNIVAKNLRGDALERKLEELLK

    >gi|256420939|ref|YP_003121592.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chitinophaga pinensis DSM 2588]
    MPKLLVCVLLAGLLSLQATTTKLIAGTGFTTGGSLKDYNGKTHTIKPRGKAVVYLFLSPECPLCKNYAPVLQAMQQKYPE
    IQFYGIVSGKTFTREMVAEYAKDYKITFPILMDPDKHAAESLRATVTPEALLIGENGREYYRGLIDDWVTGLGTKRVKAT
    KLYLSLAIENLLSGSDLTYATQPIGCLISNY

    >gi|256421005|ref|YP_003121658.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chitinophaga pinensis DSM 2588]
    MLALGLLSPLMTHAQTKEYRLKGEFKNVPPHTKVYIAVPAGFDTTVENGRENVTEKILLDSTDVKDGRFVLQGKISDPTY
    AYLALVPVADRTKIDRKTIYLEPGDITITSEGGLSTATFLGSGLNDDFVIAGMAEQQYSRASDSINGKYADDADIIRARQ
    TLDQWFNGFKGDFVRQRPASYFSLLFVRDLLGQNLIRPREAASMYEKINDDYKHTKVGLALKTNIEQLLLVENGMPAPDF
    TCQDINGKAVSLSDYRGKHVLLEFWASW
    CTPCRAESPNLIAAYQKYKDAGFTILSVSLDQEGDREKWLKAIEKDGTGAWT
    HVTELKRFKGKVPKLYAVHSIPFNFLIDPSGKIVAKNLRGEALGATLQKIL

    >gi|256421086|ref|YP_003121739.1| thioredoxin [Chitinophaga pinensis DSM 2588]
    MKLIYIYDALCGWCYGFTPVIERLQQQLGPATEVEVLSGGMLLSSNHRPAAAMYNYIKEAHKQVEATTGVQFGEAFLEQY
    LRTDDIMDSEKPSIALTVFKQYLPQKALSFAHDMQLALNYEGKSLNEDATYRDLIAKYRLPVDEFLEKMKDDANRYDTIQ
    EFNQVEQWGITGFPAAIFDDGTQYYLIAKGYTPLESLLEVIKKIIRGN

    >gi|256421123|ref|YP_003121776.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chitinophaga pinensis DSM 2588]
    MKYLLTLISLAAVIPCKAQFVLDGKVSGYKGKYIYLQYADDKGTYIRDSATVKNGLFRFSGNVSEPFMAALKNSSDPRSY
    NDSGNVSLFLEPKKMTISVEEGNFANAQVEGSASQKQFGAMQQQIRYVNKKWKVVMDTLSAVNKRSNFEYQELKNWVLSP
    FHMDMDEIYDRSMNQYPTSYVTAYYLRFKVNELSADSLKKWYAGFPEKVKQSKYGKSLNEDIQRKKIGIPGTMAKGFSSE
    DIDGKPLSLADYKGKYVLLDFWASW
    CLPCRKGSPHLKELYGKYKDKGFEIIGISDDDSKPDAWRKAVEKDGTGIWKHVLR
    GMKRTDSGFDRTNDKSDFYNIHALPTKILIDPNGQIIGRYTGEGEEDKSMDEKLASIFGK

    >gi|256421147|ref|YP_003121800.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chitinophaga pinensis DSM 2588]
    MPINLHCRQFIPYKLFSTLIVFLLCSFISVSYAQEKFVIRGTSLNYKGKIYLDWDHHVDTVLIKNNKFRFEGSTTGPVRA
    RLSVDSHFPIESDGLYVEAGETAITVDTTIAVSLLNNREACMININFIKAGPINEVIGPLERKIKTLAPKYIHAPEAEQL
    QFAFGLIRDLFKEHPESFAPLFYLVSTGSEAAIPQLLLDSIYRQLPERYKTTIYGGAVKKRLEYYERTQTGQVIKNFKAV
    NAAGDSISTDGFKGKYLLVDLWASW
    CAPCREEIPLLKVLYEQYKGNQFAILGVSIDRDRQDWLTAVEKEQLPWVNAIDPR
    HFDAEIYRYFRANGVPFNLLLDPEGKVVGVNLHGEALRNKLAEVLKQ

    >gi|256421152|ref|YP_003121805.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chitinophaga pinensis DSM 2588]
    MKIQFVLLAAALCSTASGAIAQQKTKQFVLEGILTAGNPDSVRWTYADAAHKQVVIVKAVKDHRFKISGNIGGPGTASVS
    FVFKGQQTTDKHVQSGKDYRVFFIEPAVMKMTGDATALQTLTLSGSETQRESEALERMLKPIEERSTALRAAIKQTTDTT
    AKRVQRAEMDQLQEQRNKTYYTFMLQNPHSYVTAYYLNFYMPFYSTAAIRKVYDLFTPAEQHGLLGKAIGETLRGMEAGA
    PGQQAIDFSVSDINGKQLSLSDFKGRYVILDFWASW
    CVPCRHSHPHLIEWYNKYKGKGLEIIGIASDDGREAAWKNAIEQ
    DGIGIWRHVLAGVDQQKVMQRQSNPRDITIKYGVTALPTKLIIGPDGKILARDTGDGDQIGKELEKIFNN

    >gi|256421153|ref|YP_003121806.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chitinophaga pinensis DSM 2588]
    MKRIFTAALLCMPGMLLAQKPFKLSGKVGVLDKPARAYLLYSYNSKTTLDSTDISAGDFAFSGKLDYPVTATVIISHDGK
    TMREMREQDKLNIYLEPGDRTMLPADSIARSGVNGSAINDAYVKLCNALAPVEMELMNIYRKYAIATAEERKSESFKKEM
    EAAEEANDKAKKAVQLDFIQRHPNSIVSLHTIQDYGGAVPQYEVVQPLFEGLAKEIKTSVPGKKYSEYLVKISRTAIGKV
    APEIALPDTAGNVIKLSSLKGKYVLIDFWASW
    CGPCRAENPAVVEAYNKYKSHGFEVLGVSLDKGPSKSAWIKAIKDDGL
    TWLQVSDLQYWKSPTAGEYGIRAIPQNFLLDPEGKIIAKNLRGEELDKKLKETFAM

    >gi|256421219|ref|YP_003121872.1| alkylhydroperoxidase like protein, AhpD family [Chitinophaga pinensis DSM 2588]
    MQTRFNMPQVEPEGYKALLAMEKYLQTTKIEPLHKELIKIRASQINGCAYCIDMHTKDARKYGETEQRIYALNAWRETPF
    FSREERAILALTEEVTLISHHVSEATYNEAIEVLGEQLTAQVMLAAVAINSWNRIGIATNLMPAKS

    >gi|256421245|ref|YP_003121898.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chitinophaga pinensis DSM 2588]
    MKTSVLFLACFLLVCGISELSAQTTPTTTYILPNGKVLPADKLDSLRSAWGPGRLVFSHNAKDDREGVMHLVKITDEMAQ
    KMKEANTKRQQLLNDMVDKPAPGFALRDLNGKKWSLKNLKGKVVVLNFWFVT
    CPPCIQEMPELNELTKDYQSKEVVFLAM
    TYNDKEEVTDFLEDHTFDYNLLVDSHDTDQAYNVASWPVSFVIDKEGIVKFVVKGGQATIRQQLTKAIEQVL

    >gi|256421305|ref|YP_003121958.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chitinophaga pinensis DSM 2588]
    MWKHLFLLLASFFPIAVCAQVKEPFDKYIAAVSQPGLGEVVPDLRFHNVLNYKKQQVRLSEFKGKAILIDFWASFCQPCL
    AQFPKLQGIQDKFQKELQVITITSDQQEKIVHMFNNIRSQGFKMLTATNDAKGSNDIIFSTFPHKYIPHYVWIDKNQVLK
    AVTGYEELTEDNIAKLIAGNSLSDVNHKTEDILNMSHPALFTYQELGMAEKMMLNDSIAGLLEYSMLSGYNKKYPPSSGI
    DFTGIYAERRIRLWNLPLCTMLRLAFGKLSTDPREQELVPMPRVFFNIRDKAILDKLLVNFTEAPDSTSDMYCYDLIVNK
    KGMRSLQDKMKEDLYKYFGVRGTHVKKKIACYVLTMKDSLKLTASDENYHEEGNMYYLKLKNTPFPKLVQHIKGYNENSK
    SSPYRGLESAIIIDETHFVSRIDINLTVCMNDIPALKSALAQYGIELCEDERMVDVLLLED

    >gi|256421338|ref|YP_003121991.1| transcriptional regulator, AraC family [Chitinophaga pinensis DSM 2588]
    MTTQELTDYERIANAIDYLKENFKKQPSLEEIAENVYLSPYHFQRMFTEWAGVSPKKFTQYLSVEYAKTLLKEKQTSLFD
    TAIETGLSGTGRLHDLFMKIEGMTPGEYKNGGEALSINYSFAESPFGPLILAATPKGLCYLAFGENRDLAFRELQEQFPN
    ARYTQVLDMIQQNALYFFTQDWSTLGKVKLHLKGTPFQLKVWEALLQIPMGDLSTYGQVAIAAKADRAYQAVGTAIGNNP
    VAFLIP
    CHRVIRSNGEFGEYHWGSTRKMAMIGWEAAKSAPFDKA

    >gi|256421489|ref|YP_003122142.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chitinophaga pinensis DSM 2588]
    MFLFYCDTNKKYPSFPSPFTIPEMKKTLAFVYLLLCYTLTISAQSKITRYSGTIKGYHPDMGFKTVQLSNNNAVTGLYSS
    YLINIAADGTFEVALPLTREQEVWVGFPFFNSPIYLEPGKELIQNFDITSPSAVTSVFKGVPATVNNDINKVRPILMDFD
    WDAIDKAIYSMTPEQYKLYFQQIQQRKLSQIDSIAKKGAFNKTAYDLAQRNVKYSTADLLIFYRHMMESAYRHVNKLSFD
    NKQPLSKPVKPDSSYYSFLKELKYNDPLALRSYNYFILINRLMYMEPVYDQARTEGADYEKELAILKTKDTSDLGIKNTI
    NHYEEMIARNATIPGALERARPVVFKKLLPVSSSMETDIVYLQSITREMDINKDTLSAEKLATIKSNVKNPFLLADVYTL
    DNTIKESIRNAKTQKGYSYNQLAATTANDSMLTTILEKYKGKVIFIDFWATW
    CGPCMDAIKRIAPLKEELAGDKNIVFLY
    ITNTSSPEKSYDVIMPGIKGEHYRLSTDQFNQLSGMFNIVGIPHYAIVDKRGTIINKNFIWTQNDQVKEQLLRLEKE

    >gi|256421637|ref|YP_003122290.1| beta-lactamase domain protein [Chitinophaga pinensis DSM 2588]
    MKVKQFEDKSLAHYSYAILEPGSASVVLIDPARDPRPYLDYAAAQGAKIVAVIETHPHADFISSHAELKELTGADIYCSV
    HTDADYAHKTFDDGQTISIGTMTLRAINTPGHSPDSISIVLNNAGQDYTVFTGDTLFIGDCGRPDLRENAGNQKAKREAL
    AGQMYHSLRDKLLLLADDVVVYPAHGAGTLCGKDLRDASQSTIGEEKKSNWSLQSMEEADFITTLLKDQPFIPQYFGYDV
    DLNRKGAPALQASLSAIRILQPATAFIPDEIVIDTRPAESFKAGHLPGSFNIMLEGKFETWLGAIVPPEDPFYLLAATQE
    QLQAAMERAARIGYEPFIKAGLILDSGSEQQTPFDPVYFREHSKDFTIIDVRNEPEVKKRQIFPHALHIPLPELRLRLKE
    IPLDKPIAVH
    CAGGYRSAAASSILEAALPDNLEITDIGEHIKEF

    >gi|256421639|ref|YP_003122292.1| protein of unknown function DUF395 YeeE/YedE [Chitinophaga pinensis DSM 2588]
    MTMLRYLSQPWPWYIAGPAITAVMLSLLYSGKTFGFSSNLRTICSIAGAGTKVPFFQFDYKKQYWNLLFLLGAIIGGFIS
    RWLMNSGQLQLSGEAIRDLQALGISFDGQLLPTALFGTQALLSFKGWIMLAGGGFLVGFGSRYAGG
    CTSGHAISGLSNLQ
    WPSLIAVMGFFAGGLIMTHLFFPLIF

    >gi|256421688|ref|YP_003122341.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chitinophaga pinensis DSM 2588]
    MKITSILFITLQLLAGWQANAQHKDALNARFNTMTRETSPEKNVAAIAALIKAFKLDTIKDAGDIDIMKGITALTFLKVK
    DFPHFEVYISQIKNPFNQTSYLNMAVNELINNKTSLTYAELTAKKTVDLYHSFKDDPSARPADFPLQDWNRFMSMAQYPY
    YRSYAEILHINKKDTIALDYIEKAFSYLPLDKTDQSSAELYAALLEANHREDDAYDILLNSASTGNASLQMQQQLRRLLI
    KRTGNAVQVTHFLDSLQRNIVQAYKQELMNKMIKDIAAPGFTLTNTEGERISLADIKGKVVVLDFWATW
    CAPCKAAMPAM
    EQLKHTHPELCLLYVATMEKGADAISRINQYLKKHMHPTSTLIDVPVAGHPDRFTTAGAYHVKSIPCRAVIDKKGKLRFL
    SEGYTSDTALINEMEAMIDIAKEQ

    >gi|256421806|ref|YP_003122459.1| peptide methionine sulfoxide reductase [Chitinophaga pinensis DSM 2588]
    MAISNNIKAAKATFGGGCFWCTEAQFQYLDGVISVESGYAGGTVANPGYEDVSTGTTGHAEVIQVTYDPVKISYDELLQA
    FWQSHDPTQLNRQGNDVGTQYRSVIFYHNEDQHKLAELYKQKLDASGAYDKPVVTEIAPLTDFFKAEDYHQNYYNENGSQ
    PYCHFVIQPKLAKFKKVFKDKLKTN

    >gi|256421817|ref|YP_003122470.1| alkylhydroperoxidase like protein, AhpD family [Chitinophaga pinensis DSM 2588]
    MIDFSVPTREQIYPGNEAAFDTLQRRLGMVPNLYATIAYSENGLNKYLAFQTAKTSLYNRERDAVSLVMAQVNGCRYCQS
    AYTSMGRKNGISEEELMAVRTGNSSHPRLSALAGQTKEIAENKGRVSVDALERFFEAGYDKGNLVDLILQISDNIAMNYL
    YNLTQIEIDFPLAPELVEENNA

    >gi|256421904|ref|YP_003122557.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chitinophaga pinensis DSM 2588]
    MLNVKPFSLLIFSIAICCLPLTVLAQKGYTITGKVGQLKVPAKAMLLTVQNGAFRNQDSAIIKNGVFQFKGKVEEPKQAI
    VSIIRDGAKGAEASNDYISFFLENSKITLKGTDSIRNAQIEGSIADKQNRDLEASIQPYTRLIIRLNDEFRGKPKDDAWK
    KASDSVTNAIAQIKLLNARFAESHPNSFMGLYVYHYNVLGSKFNPAEVEPIFQKFSPALQSSPLGIRTLEKLTASKKGQA
    GVKVTDFTQNDLNGTPFTLSSLRGKYVLVDFWASW
    CGPCRAESPNLVKAYEQLKNKNFEVVGVSLDENKGAWEAAVKKDG
    LPWIQVCDMKGWKNDVAVLYGVNSVPQNFLIDPNGVIIARDLRGEGLTEKLSTLIK

    >gi|256421905|ref|YP_003122558.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chitinophaga pinensis DSM 2588]
    MKTIRLILGTMCLLPLGLKAQNSFSVQGKIAPKDVPSMVFLNYYEEGKSVKDSVMLQKGQFSFKGKVSSPSEAMIYLKEQ
    DAKQTTGGDEITFYLENSKITITSPDSLWKATVKGSKTNDDQASLRLLQRPYRKVADSIMRVYNSWTPEQRKDTALTKTL
    APPMRASQAGYDSVNRAFISSHLNSFIALRVFKEMELGYDFNPDTAEARFARFPAKLRESYSGKKLASMIEIGKKTNTGV
    VAMDFIQNDTTGKPVKLSDFRGRYVLVDFWASW
    CKPCRAENPNLLKAYNKFKDKNFTILGVSLDDEDGRKAWLHAVAKDG
    MPWTQVSDLQGFKSKAAIDYGVNAIPANFLIAPDGKIVARNLRGDDLEKKLAQIL

    >gi|256421926|ref|YP_003122579.1| OsmC family protein [Chitinophaga pinensis DSM 2588]
    MKRTAKAQWTGNAKEGKGELTTQSEILNKTNYSFKTRFSGEEKGTNPEELLAAAHAGCFTMAVSFALTEQGTPPALLTTE
    ATLSMEGFAISGIHLSITGIIPGISLDTFSDFVRAAEKN
    CLISKALSIPITSEAHLTFIEN

    >gi|256421951|ref|YP_003122604.1| methylated-DNA/protein-cysteinemethyltransferase [Chitinophaga pinensis DSM 2588]
    MTIEHIHIITTPVGSLTIIGNDHAINTLTFKEGRVPTQEPLSDIMLQCVEEINAYFAGSLQGFNFPVAQPGTEFQQTVWQ
    QLKDIPYGQTISYLQLAKRINNPKSIRAVGTTNGKNRIAIVVP
    CHRVIGSDGSLTGYAGGLWRKKWLLEHEIKQKFGSLE
    LF

    >gi|256422047|ref|YP_003122700.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chitinophaga pinensis DSM 2588]
    MKSFIKENTRSIFITLLLSFTTATVANAQRVSRDSSMMMDKMEPQQMSYTIPQKPEDISPLLNGEKIPKAILTDLSGKKF
    DLNKAVSEKPTVLVFYRGGW
    CPYCSRQLSGLQQAAPDLEKLGYQLIAISTDTPEELMQSATKEKLDYTLLSDADLSLSKQ
    FGIAYKAPEAYWNMLPKTTGGLDTALLLPVPSVFILDKKGTIHFEYINPDFKQRLSADLLKAVTNSIRKDL

    >gi|256422060|ref|YP_003122713.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chitinophaga pinensis DSM 2588]
    MKLNIKKISIAALLAIGCSLTFNAPVAKAQDATDQKTLTQGDKAPNFSLKDQDGKTFKLSSVVGKKKLVIFFYPKDESPV
    CTAEACAFRDAYEKYKDADAIVIGINNGTVESHKAFATKNHLPFTLLSDPGNVVLNKFGVKEQDFGNNMKASGRETFVIG
    LDGKVVYSFRDFMKGDEHSSKVLSYLSGK

    >gi|256422102|ref|YP_003122755.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chitinophaga pinensis DSM 2588]
    MKNVTLSLGASFPEFKKTAVVSIEKGKEFYELSSEELKNSGKWLVMFWWPKDFTFVCPTEIAEFNKHYQDFVDRDAILIG
    ASTDSEFVHAAWRRDHEDLRNLQFPMLADTSKSLAEELGILEANEKVAYRATFIVDPQGIVRWVSLYDLNVGRSVKEVLR
    VLDALQTDELCPCNWEKGQATLNA

    >gi|256422164|ref|YP_003122817.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chitinophaga pinensis DSM 2588]
    MKLLILKSTILFFSFLLVSGHLFCQNKFNSQGARMSKISGHIKSEKRIDSIMFYWDANEDIADWHNWVITVPVKEGYFSV
    SCILKHVAQFAVGYNLNNVFYLEPGDSLHIEIVENKEWDQLTFSGRGAFKCRVQQAADEINTNMIKSENKAKFVCSGLDD
    YLITSNYYKDLQRVRLAYLESKKDSISEDVYPLVQASILCPLEHYRLSKLDDFVRKYKQFGLTEKDLLAIYDSTVNKSFI
    NKIAYNKNLAYSLSYLSYVHVTAIPNKVKWEMRKSGASVSSLDFTYHNEYLLSKNSYSGMFRERILTRLFRKYIKYVDLS
    SSFLKSDIEDYLSETGFKSYKEFVKGLYQKSNSFSKGNLAPNFSLVDNFGKKVTLDDFKGKVVLIDFWFTG
    CHPCAQLVP
    TLRQIQQHFNDNPNVVIINVSIDKEKEQWLNSLAKGKYSTGLGVCLYTEGKGNRHQIINDYGVQGYPRLVIIDKSARIVR
    ASPPDSRPLGNGQDEIELINRLLK

    >gi|256422178|ref|YP_003122831.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chitinophaga pinensis DSM 2588]
    MSSFSRIASICILYVCCLFNNSCIAQGGAGRKINYKQLVDSAMSHIPLKVGDPLPMLQISSLYNYSNDVLDFSAFKGKII
    ILDFWATW
    CGPCVASLPKLDSINTTFKDSIIIIPVTYQTTNEVQKFLSKSDKLKNIKLPFITEDTVLHKLFPHKMIPHEV
    WIGKDGKVKAITEATEITEANVRQAMNNQELSLNMKEDNLTFDDTKPLYTDPSILKRASITSYSLFAEKIPGLASSLAIF
    RDSLDAYSVKRFVGLNVRILRLFYSTYSVPRELMGAVNRKRFIVDLAGSDTNDVKQLVAYEFALKNAIPQEAFFKGMLED
    LNNKTPYHGHIETRIGKCWEIRQIKGVNSNDSSGFRLTGKDIDSTNLWKFANVKKLATFLNAFNNVEPVVDATTGSLSQS
    INLYMRLDINEYPNWTEIRKNLKKYGLTIEEATREYEVFILKKKSNNGLTSDKNGFR

    >gi|256422307|ref|YP_003122960.1| Redoxin domain protein [Chitinophaga pinensis DSM 2588]
    MKKMILLLAALAGMKATYAAPSPAMISGNCALKTANGMKLYNVKEGRLVEFASTTLDTAHNFAFAIPVPTAGYYYLAMSV
    DGKASRNNIRVYLQAGEQVTLDIQDDQGHYSVLKGGEENKLLYTWQQLIGPLKSKTSLNDTTTYRAFFPAVDAIQPAVAT
    FKKSIHTKNGVFNRLLTMTVDADMESTAMGILVMPRSMHPDRKHMPAYYNTILQPKHYCSAAILELGEGADLVQRYAMLA
    ASRLDSITLANRVELSLSVLCNDTLKGVWLMNDFRSYRSLEKFDAVFAPYKQYLLTDNMQKALFETRKALSTFKKGTTGY
    NFSFPGINGDTVSLASLKGKVVLVDMWATW
    CGPCKKEIPFMQELEAAMYGKNVAFVSISTDKAEDKEKWKAFVKEKKMGG
    IQLFAGGWSDMQKFYDVNGIPRFMVFDKQGNIVSVDAPRPSMPELKPLLESLL

    >gi|256422346|ref|YP_003122999.1| protein of unknown function DUF395 YeeE/YedE [Chitinophaga pinensis DSM 2588]
    MNILTTPWPWYVAGPLIGLTVPLLLLLGNRHFGISANLRHICAACLPNKIPFFSYDWKKESWNLFFAAGIMIGGYIAVTF
    LASPTPSVIALQLETELQGYGLSYTGSLLPADLFNWPALLTARGCILMVAGGFLVGFGTRYAGG
    CTSGHAIMGLSNLQWP
    SLVATCCFMAGGFIMANLILPFILQL

    >gi|256422371|ref|YP_003123024.1| iron-sulfur cluster assembly accessory protein [Chitinophaga pinensis DSM 2588]
    MITVSEKAGEYIKDLMVKENHAPGTFVRVGVKGGGCSGLEYVLKFESSEHEEGDQTFEDKGVKIVVQMKSLLYLYGTELD
    YSDGLNGKGLYFNNPNATRTCSCGESFAV

    >gi|256422449|ref|YP_003123102.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Chitinophaga pinensis DSM 2588]
    MTGKNNFDVIIIGGSYAGLAAAMSLGRALRRVLIIDSGKPCNRQTPHSHNFLTRDGSTPAEIAAIGKEQVLKYDTVQFYT
    GLATRGVKTETGFEIGTDKGDTFSGTKLIFATGITDEQPAIPGFAECWGISVIH
    CPYCHGYEVKQEKTGILANGDMAFDF
    GKLISNWTDELTIFTNGASTLTPEQMEKLAQHNIAVVEKVITKVEHDKGYVRQLVFEDGRTFALRALYARVNFTQHCDIS
    VQLGCELTEQGYLRVDAMQKTTVPHVYACGDNSSMMRSVANAVSTGTLTGAITNKDLIDESF

    >gi|256422558|ref|YP_003123211.1| alkylhydroperoxidase like protein, AhpD family [Chitinophaga pinensis DSM 2588]
    MATRTFIGKNHPELYKVMADLDKAVHAAGIDKWHHELIKIAASHFNGCAYCVDKHTQDAMALDIPVRKIVLIPVWHEATD
    HFTVEEQLILQLTKAVTFIHEHGIADALYDECLRVFGEDYTAKLIMAATLINTWNRIGVSFKLQPKF

    >gi|256422629|ref|YP_003123282.1| OsmC family protein [Chitinophaga pinensis DSM 2588]
    METNNNTTTKVFTPVEKVLYTGRTHTTGGRDGVSRSDDGKLDIQLTSPGFPGFGTNPEQLFAAGWSACFIGAMRLAAGQQ
    HMKLPEGSYVDAEVDLGSNTNGFQLQARLKIHLPGLDTETAQLLVDAAHKT
    CPYSKMSRGNIDVNISLV

    >gi|256422741|ref|YP_003123394.1| OsmC family protein [Chitinophaga pinensis DSM 2588]
    MKISLKRLDDAFNMEAVDEGGHIVQMDSSVENGGKNNGVRPMQMLLMGLGGCSAIDVAMILKKQRQELTDFRIEIDGERE
    KGKEPSIWEKVHIIFHLSGDIDPDKAARAVELSMTKYCSVAETLRRAGGDLTWETRVNG

    >gi|256422746|ref|YP_003123399.1| Rhodanese domain protein [Chitinophaga pinensis DSM 2588]
    MALHNRVSAAELKVRLAAETFRRTTISFYQYAKIEDPTAFRNELYERLFTLGVFGRIYVAHEGINAQISVPEYNVDAFRD
    VLYSYSFLNGIRLNIAVDDDGKSFWVLKIKVREKIVADGIEDPTFDITNRGKYLDAKGFNELTEDPDTIVVDMRNHYEYE
    VGHFQNAIEVPSDTFREQLPMAVDMLKDQKDKNIVMY
    CTGGIRCEKASAYMLHNGFKNVFHLEGGIIEYTNKAKEQGLPL
    KFKGKNFVFDDRLGERITDEVISKCHQCGKPSDTHTNCANDACHLLFIQCEECAAAYEGTCSTDCKSVLHMPEEERDELR
    RGVDKGQMIFNKSKQRLRPRLEREND

    >gi|256423085|ref|YP_003123738.1| hypothetical protein Cpin_4077 [Chitinophaga pinensis DSM 2588]
    MKPTITIEYCPKCGWMMRAAWMAQELLTTFAEDIYSVTLQPSETNGSYIIYVNGVAVINRKELGHFPEIKEVKQVIRDKV
    APEKSLGHSDRK

    >gi|256423123|ref|YP_003123776.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chitinophaga pinensis DSM 2588]
    MAQEKKGPFQLDGTITGKNSGFVHLRYGNGFYMEDSCAIKNGSFSFKGMLSEPVMATISGDGEDGYDFYLDPGQMTINVK
    SPSFEDAAVTGSASQTEYQELLTARADVQREIAPLAKSLEDANKQYLSAIQSRKSDAELTALKSKADVAKGSLAPLEERA
    REVSYDFFRSHPDSYVTAAELRYFATYMKPGDLKSHIGKLAPFLQTSIYGQELSDILNKLQNGAPGSQAQLFSQRDATGK
    AVTPLDFKGKYLLLDFWGSW
    CLPCRKNNVHLKELYARYKDKGFAIIGIADNDSKPEDWKKAIDKDGIGIWTNILRGLDAN
    KFKEDGKPQPGDIYNMYGVHAVPTQILINPEGMIIARFGSGGENYELLDTKLAEIL

    >gi|256423163|ref|YP_003123816.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chitinophaga pinensis DSM 2588]
    MATTQTLSTGDRIPDFSLQDENGQLFNIRDYVGKKKLVIYFYPKDESAVCTKEACSFRDSYADFTDAGAIVIGINAGSVE
    SHRSFKEHHRLPFTLLSDPGNKLLKQFGVKNVLFLTGRETFLVGLDGKIEASFRGFLKGDAHAEKMLAMLRVNV

    >gi|256423321|ref|YP_003123974.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chitinophaga pinensis DSM 2588]
    MKSIVCFLMILICPGFIFAQKKFKVSFIVPDSTIIKNLSFSYYDYKERSDISITPVYEKNKATISHSYNTLYAHIRAELP
    SGNSWPAMTIFVTEKPATVTFPEHMNAADPFCSYTLTNAKDPKEEFRVANAHTQEARKHYQQVYDSVAANWTPADSLGYK
    RFREALLAIDYKKLEYISDHPNDYSSFITFERYTSSLLPPDLLLERFNTVFPANFRDSEEGAGVKRYLQDRAILEGKKKA
    ISFTTKDIDNNKIVLEEVYSKKHVLLVFWGTW
    CGPCIEEIPTLREIRQQCPEEHLEIISLASRSPLEKVREFIKEKQMNW
    KHVVNDEDIRLLYQIHGYPEVILIDTKGNIIYKYSDYPDLHLQSLKKMLASLESNQ

    >gi|256423540|ref|YP_003124193.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chitinophaga pinensis DSM 2588]
    MRKTIPVLLSAVLATGIQSAYAQKKPAADTLTKHYQTLLKGNDADRSQLESEMYALLKTKKEENWITASNFVYQLKKANV
    SDSIRKAAEKRFPGGILERNNAVQSIYDEKDPVNKEQLLSAWIKKYPPKKFGPDRIIYDYARNAVGMAYTEAGNLPKALE
    YANSIESPFWKGQAWAGTAGILIKQGHYAEAKTLLRKAVDNAWEFKTTRKNETGAGFAAIGYPGYLSSYVACLYEEKQYD
    SALIYIRRAEKAEDPVRPSVIEMYAKILLSKGDYDTAYTKLSNLAGRGLLNPITRKQLEEAYTKVRGVSGFQPYLDSLKG
    HLNSNIEEEMAKQIIKQPAPNFTLKDVDGNTVSLADLKGKTVVLDFWATW
    CGPCKASFPSMKKAMEKYKDDPNVKFLFVH
    TWEKEENAAVSAKKFITQNNYPFQVLMDLKDPNTGENKVVSSYEVKGIPTKFVIDKNGDIRFRFTGFTAGEDAAVSEVAA
    MINLANK

    >gi|256423695|ref|YP_003124348.1| thioredoxin [Chitinophaga pinensis DSM 2588]
    MALEFTDSNFQTEVLDSDKLSVIDFWAEWCGPCRAIGPVIEDLSKDYAGKVNVGKVNVDQNPQLSINYGITSIPAILFIK
    NGQVVDKQVGAAPRAILEKKIQTNL

    >gi|256423942|ref|YP_003124595.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Chitinophaga pinensis DSM 2588]
    MRKFDAIVIGSGQGGVPLAKKLAKAGWQTAIVEKRWIGGTCINDGCTPTKSMIACGAAAHVIANSQEWGITVSDFKVDLE
    KIVQRKNKVVESFRGGATKGMEKTEGLSIIYGEAVFTGEKTLNVILKDGGEEAITAPHIFINTGTLPKIPPVPGLDTIKY
    LTNTSIMELTKLPSHLVIMGSGYIGLEFGQLFRRLGSQVTIIDRGKQLLKHEDEDVAAAVKKVMETSGVTMHTGANVQKV
    EQIGDTIRLQFTANGENLTITGSHLLVAIGRTPQSTSLQPEKAGLALDDKGYFKVNDQLETNVSGIYVLGDVKGGPEFTH
    ISYNDYLVLYKRLVNKEDTSIKDRPVPYCMFTDPQLGRIGLTEKAAKEAGYDVKVACLDMTRVARAIETGNTQGFMKAVI
    NANDDKLLGVAILGPEGGEVMSVMQMAMLGGITAKQLREMIFAHPLYSESINNLFMTLEK

    >gi|256423981|ref|YP_003124634.1| DSBA oxidoreductase [Chitinophaga pinensis DSM 2588]
    MKVEIWSDIMCPWCYIGKRRFEAAMEQFPDAGSVEIEWHSFQLDPTIESGHGDNLYTYLSKRKGIPYEQAEQMNNQVTGL
    AATLGLTYNMEQAVVANSFDAHRLIQLAKKHQLGDAAEERLFKAYFTEGKDFSNPDTLVALGKEIGLEESVLKNLVGSQS
    FTTEVRRDIDEAETLGIRGVPFFVFDRKYGVSGAQASETFLEVLTKSVGEWKSTQPSDLEIIEGQTCGPDGDC

    >gi|256424123|ref|YP_003124776.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chitinophaga pinensis DSM 2588]
    MKNILLLTLVCGLGLHTAAQDTTMLSAQKKELTGFLADADAKLATCQQQYYDAQKAKGHYDTIGLGEWRYQMKLLKSARK
    AQEINFIRQHPDYMVSLDALKDVIGPLPDNIKSYNALYNGLKKNIRQSEAGINTKKMIDKYMTVRVGAIAPAFTAPDTSG
    QNISLKDYRGKYVLIDFWASW
    CGPCREENPAVVKAYQQYKDKNFDILSVSLDQPGKRAEWIKAIQKDGLSWQHVSELKYW
    DSNVAKLYAIRSIPQNFLVDPKGKIIAKDLRGEALATKLEEILK

    >gi|256424323|ref|YP_003124976.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chitinophaga pinensis DSM 2588]
    MSVLALSLGVTYQAYSQTDSVRLTGLGTPVAGDTLRLSYNPAGGPLQGKEKIQGIIYLFNNYRWVVDDIALVKHKGILEG
    KYGVPANCAFVAIRFVTEENGYVVLADNNNDFGYVATTVDKQGAKLPGGVLAWGIFRKPSIHKAPDGYFDKKDISDEALE
    MWVRKEMEQYPQNMPKYFDSYLTMLKISKGDEFPVVAPRNLERFARLPGIDESGYQLIWDTYRFGLKDTQKADSVKKVIT
    QLYPHGRVMRFDKYSAAFSRDAATDQKIADMEGFLKEFPVADYRKDSTATQGFIYLNAYRTLASLYFDKGQYDKLLAMIP
    DMDFAALNEIYHANIHKAFSLKQMPVDQLYPISKAFIDAMLQKRTDLSYMDGTRNTPRQATENATRQLDTKLAVHIRLLA
    KMGRYNEASPYLAQLSEAGKYSNANLNETRIAILENTGNQQMVLPTLEMAIKVNTATPAMIEKLKTLYTEKNGQATGFEQ
    YRESLKSAEDISKTKAEIQAKLINEKITAFRLTDINGKTVNSADWKDKIVVIDFWATW
    CGPCKMAFPGMQMAVDKYANDP
    AVGFYFISTMETTQDYKQKVKDYIKTSGYRFNVLYDEQTAKNGVNNKVFKSMAPVFQSSAIPRKAIIKNGVMRYTAEGYQ
    GSPSKLYDELTYVIELLKAEN

    >gi|256424398|ref|YP_003125051.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chitinophaga pinensis DSM 2588]
    MGWKRLFSLSNISTAVMTVFLVLMLVNPSVKAAVMQGLMKVGLFQPGVPEEVAPESKMAPDMAFADGEGNTFTLSSLKGK
    VVFLNFWATW
    CPPCRAEMPSINSLYKQYKADKNVVFLTVDTDGNYKKAKRFIEKQQYELPVYVADSRIPEELLGKSIPTT
    IILNKKGQIVYRQEGAADYGNDRFIDYFGKYIRK

    >gi|256424466|ref|YP_003125119.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chitinophaga pinensis DSM 2588]
    MILFGKAQGQLKAGDKVPSFQLQDQNGQTFDINTVLGKQPLIIYFYPKDETSGCTKEACSFRDAYEDFTSLGAKVIGISG
    DDVASHKSFAEHHRLPFTLLADKGNKVRKQFGVPKTMFIPGRVTYVVDKQGVITYVFNNLTDGPKHVTEALEALKAIRN

    >gi|256424569|ref|YP_003125222.1| beta-lactamase domain protein [Chitinophaga pinensis DSM 2588]
    MKIEQLYTGCLAHGAYYIESNGAAAIVDPLRDVAAYISRAQQDDAVIRYVLETHFHADFVSGHLDLAAATGANIVYGPGA
    TPAFPAYIATDGEILTLGDIKIKVLHTPGHTMESSCFLLIDEAGKETALFSGDTLFIGDVGRPDLAQQASGKTRDELAGI
    LFDSLRNKIMPLPPEITVYPAHGAGSACGKLISGQRTDTLGGQLRTNYALRADMSREEFITAVTDGLTPPPAYFPLNVQM
    NKQGYENVDNVITRGTRPLSPEAFEALANETGAILLDTRGPELFVDGFIPGAVNIGLDGNFAPWAGTLIPGQQPILFIAD
    PGREQEVVTRLARIGFDNTLGYLKGGFEAWRAAGRTVDDIVTITPAELAERLSWIPVQLLDVRRRNEFSGEHIAGAVNIP
    LEYINDHIGQLDKQQLYYVH
    CAGGYRSVIFISIMRMRGYHNFVDIKGGMKALKESGLFQLSDYFTPSSTL

    >gi|256424600|ref|YP_003125253.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Chitinophaga pinensis DSM 2588]
    MINEKQTDVIIIGGSYAGLAAAMALGRALKNVMIIDSGLPCNRQTPYSHNFLTQDGQTPANISAIARQQVAQYPTVQFLN
    DLATDAVQTGTGFNIRVASGDSFQAHKLIFATGIRDILPDINGLSDCWGISVLH
    CPFCHGYEVREAKTGVLGDGDYGLEF
    SRLIRNWTTDLTLFTNGSATLTPEQYALLQQQHIPVVEKRIRELVQENGYIRHIVFEDGTTAPLTALYTHAPFEQHCPLP
    EKLGCACTTEGYLITDHTQQTTIPGVFACGDNTTRLRTIANAVSMGTAAGIAVTKSIKN

    >gi|256424693|ref|YP_003125346.1| methylated-DNA/protein-cysteinemethyltransferase [Chitinophaga pinensis DSM 2588]
    MQHFYKYMNTPVGRLTLIGSDEGLAAILWENDNPGRVRPKADVRNDQHPVLIETERQLQEYFNGERNEFDITLAAIGTDF
    QKKVWNALSTIPYGQTRSYTQIAHQIGKPQAVRAVGAANGRNPISIIVP
    CHRVIGASGSLTGFAGGLPAKASLLSLEDTN
    GGASQLSLQL

    >gi|256424718|ref|YP_003125371.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chitinophaga pinensis DSM 2588]
    MKKTFLLFAALIPMLAKSQSKNTFTITGKIGNLDPNARVYLDWTDVLNDGGKEDSVDVVNGTFKFTGELSGVATCRMALA
    HHGDGKMKAVYAGDAIYFNFGPENFTITSKDSLANAVFKGSKVHDQEDAYNKKIGGQIMAITKNANYEFNAGTPEQRADS
    NFLKEVDMRFRKRVGDRNAAQLQFAKDNPNSVFGLIALSEYTNMSKNMEVVTPVYNALNAKLRNSKKGLELDKRIKSVKL
    TTPGAEAPNFTMKDTNGNPVSLKDLRGKTVLLEFWASW
    CSPCRAENPNLKAQYAMYKEKGFEILGVSLDSDKKKWEEAIA
    KDGIPWIHVSDLKGWGNEVGILYGVTGVPAGFLISPEGKIIGNDLRGESLNKKLAELLNK

    >gi|256424735|ref|YP_003125388.1| hypothetical protein Cpin_5766 [Chitinophaga pinensis DSM 2588]
    MRVMNVLTGGLVFLLMSFTVWEPDFEVARKTARDKNQLILLNFSGSDWCGPCIRLRKEIFDSEQFIKMADTTLIMVNADF
    PRNKKNQLERRVQQQNESLADKYNPGGKFPYTVLLNADGKVIASWDGYPKTDAAHFTEDIKKLCDANTH

    >gi|256424910|ref|YP_003125563.1| Rhodanese domain protein [Chitinophaga pinensis DSM 2588]
    MENISAADVKQRIDSGETLNLVDVREPHEHEDFNIGGKLVPLGEIRAMQVDELEDLKDQEVIVYCRSGGRSGQAAMILET
    MGFQNVKNLTGGMLAWQDQFGK

    >gi|256424932|ref|YP_003125585.1| OsmC family protein [Chitinophaga pinensis DSM 2588]
    MQPTVESRYLGNGKSSIVSPLNTEALNADSENFRPMNFLVGGYGTCMMSVMDMIAGQNGFNLSEARTEIRFSPMPDMSRL
    DTIDIKCFIRKGDYNAAEKQILEDAATKMCPIGNSLNPEIKRSYEFVYGVE

    >gi|256424934|ref|YP_003125587.1| Redoxin domain protein [Chitinophaga pinensis DSM 2588]
    MEHSLILFKRKLLPSLKYKNMKLILTLALMSSLIFEVKGHINRKILNYSILAADSTITPELPLKDIKGNNISLSAFKGKI
    VFINFWATW
    CSPCVAEMATINKLKQSFNNNDSIVFLLVDIEEDIQKANAFLINNKYDLDVYEYAAKRLLPEEFLGNGIPV
    SVVLDRKGNIRLRFDGPKDYTSTQIKKSLTDLIEKGE

    >gi|256424940|ref|YP_003125593.1| thioredoxin domain protein [Chitinophaga pinensis DSM 2588]
    MDVLEIIKSEKPTLINFFATWCGPCHAMKPNLDQAAAHYGERINYERIDVDEYAQLSGKFGIRSIPTTILFKNNEIVWKH
    TGVYPGTEIIKRIGEHITVEQK

    >gi|256425009|ref|YP_003125662.1| methionine-R-sulfoxide reductase [Chitinophaga pinensis DSM 2588]
    MKAGFIIVFVSLLLSACQGNAQKKKDMNKENNPYYSRTDTSHLNVSNAEWKKILPSDLYNVSREQGTERAFTGEYWDSEA
    KGTYYCAVCGNKLFRSDAKFASSCGWPSFFEPVRENSVIYKDDNSYGMHRIEVECARCNSHLGHIFDDGPAPTYKRF
    CMN
    SVSLDFDPDVK

    >gi|256425010|ref|YP_003125663.1| peptide methionine sulfoxide reductase [Chitinophaga pinensis DSM 2588]
    MKTLIRQMGSYFFLLFFAPFMACAQSHPDISKSGTFKEMEKAGEAKHTGNKADTATFAAGCFWCVEEQFKQLEGVISVES
    GFTGGKVPNPSYELVCTGTTGHAEACNIVYDPSKISYDELLAAFFVAHNPTTLNRQGNDEGTQYRSAIFYHNEEQHKLAQ
    YYIKRLDDEKAYDDPIVTEVTPYKQFYKAEDYHQNYYASNSKAPYCQFVIKPKRDKFRAAFKGKLKQE

    >gi|256425011|ref|YP_003125664.1| thioredoxin domain protein [Chitinophaga pinensis DSM 2588]
    MLKFRLSSKILITSVLFLVFNSGVFAQEINFTNGSWKEVTAQAAKSGKLIFVDVNTTWCGPCRLLKSTTFKDEGVATYFN
    QHFISYSVDAEKGEGETLAEQWKVRAYPTLLLVNAEGKIVSRQIGYVNADRLLGWGKESAVQRPVAAK

    >gi|256425069|ref|YP_003125722.1| Methyltransferase type 11 [Chitinophaga pinensis DSM 2588]
    MSTEQEKKDLVRQKYGEIALQDKTGNQASCCGASACSSEVYNIMSDDYTALEGYHAEADLGLGCGLPTQFARIKTGDTVI
    DLGSGAGNDCFIARHETGESGKVIGIDFTPAMIERARINAATRGYNNVEFRQGDIEKMPVTADIADVVVSNCVLNLVPDK
    ENVFKEIFRVLKPGGHFSISDIVLEGVLPTSIQQAAEMYAG
    CVSGAIQKEAYLHLISSNQFTNITIQKEKAIFIPDDILS
    AYLSSSEIDQFRNSNTGIYSITVYAEKPAATCCAPGCCD

    >gi|256425102|ref|YP_003125755.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chitinophaga pinensis DSM 2588]
    MKLSGIALLMLASMTAVSAGAQQKFELSPERPKLGDKVHVTYRPDSTLLKTGKPVKAVAYYFDTLYHWSVVDLRLKQAVK
    GVYEADVRLDSTVGLIAFKFRAGEVTDSNDDAGYVIMNAQPGRQYKGAYAGYGMLRAERYGMGIPGYYRNFQISDTAYYF
    WLNQEIGYQQGASRALAYPFIIAYANMTMPQGGPTDTLPRIRRAAAYLMSLPDQTEKEMYEIAVIAERYLKNKGKADSVR
    TVMRQRYPKGILSKQDAYQAFIREHDPRKNFAMAEQFVLDYTPDATLDKLADISFDRVYKTIFANYIAKNDSTLLPRYAA
    KAPVSAMAQAYYKLVEIPYEDWKTLTAKQVYPVAVAIMERVEYLKAHRPKEYFYYSPEQWAEECDRIFANDQITHAQILH
    ETGRDKEAMQLANHAQERYQYSRAKLNELQAELLLKAGKNKELSEVLHNSVRLNQASARIFELLKKEYLNTHKNADGFDA
    WLSSLKDAHTMELLVEDVQKAMINRPAIPFSLDLMDGKPVSLSSLAGKVVVLDFWATW
    CGPCKAAMPGMQMAQERFKNDT
    SVVFFFVDTQERDADYRTKVKSFIAQKKYPFKVLFDKGEDAYAGYAKAIQTSGIPFKVVIDGKGNIRFAQVGYYGSPSAL
    ADEISTMVSLAREAK

    >gi|256425190|ref|YP_003125843.1| thioredoxin reductase [Chitinophaga pinensis DSM 2588]
    METNQQEHVHLLIIGSGPAGYTAAIYAARANLKPVLYQGIQPGGQLTITTEVENYPGYPEGVQGPEMMVDFEKQATRMGA
    DIRFGLATSVDFSSKPYKVTIDESKVMTADAIIIATGASAKWLGMPSEQRLNGSGVSA
    CAVCDGFFFRGKEVAIVGAGDT
    AAEEALYLSKMCSNVHMIVRRHEMRASKVMQDRVLKTSNIIVYWNTETQEVLGENKVEAVKLLNTAKNEETTVPVSAFFV
    AIGHQPNSAIFKDYLELDEQDYIKTVPGSSRTNLEGIFACGDVQDKIYRQAVTAAGSGCMAALDAERYLSAQGI

    >gi|256425202|ref|YP_003125855.1| protein of unknown function DUF1573 [Chitinophaga pinensis DSM 2588]
    MKKIFFYLIAGSLLAGACNSSDAGKKAAQETSAAADTSKGTPVIAFDEMVHNFGNITEGERVEYSFKFTNTGNGDLLITD
    ATSS
    CGCTVPDWPKEPIKPGKSSYMKVVFNSAGKDGYTEKEIIIRANTKPEQVQGPKIQCTIMKQKS

    >gi|256425217|ref|YP_003125870.1| dihydrolipoamide dehydrogenase [Chitinophaga pinensis DSM 2588]
    MAYDVIVIGSGPGGYVAAIRASQLGFKTAIVERESLGGICLNWGCIPTKALLKSAQVMEYIQHAKNYGINAGESTADFDA
    VIKRSRGVADKMSKGVQFLMKKNKIDVLVGNGKLKSKTQVEVTDKDGKATVHDAKYIILATGARARELPNLKIDGKKVIG
    YREAMVLPKQPKSMIVVGSGAIGVEFAYFYATLGTKVTIVEFMPRIVPVEDEDISKELEKIYKKKGIEVMTNASVEAVEA
    NGEGVKAKVKTATGEVFLEADVVLSAVGIAANIENLGLEALGIKTDKGRVTVDKYYQTNVPGVFAIGDMVPGQALAHVAS
    KEGIICVEAIAYGEKKYAHKPEPIDYMNIPGCTYCAPEIASVGYTEKAAKEAGYEVKVGKFPFSASGKATAAGATEGFVK
    VIFDAKYGEWLGTHMIGANVTEIIAQTVTARKLETTYQEVLDSIHPHPTMSESVKDAIEVAYGEAIHL

    >gi|256425238|ref|YP_003125891.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chitinophaga pinensis DSM 2588]
    MLKLLYSTNIVGYLTNTTIDVNFNMKKIWLLLCLPAFIFGTQLEKWDLEPGVWQASLHRKDGADIVFNFEVKDSARKKLI
    YVLNANDRLLVDDVKVQGDSVFIKMPFFDSEFRASFTKGGQIQGSWIRHLADRDVSIPFTAAHNVKQRFEQHTPAKGNVT
    GRWSTWFTSPGKSDSSFAVGEFRQQGNTVHGTFLTSTGDYRFLEGIVDGDTLKLSTFDGSHAYYFTALVKDNFLENGVFY
    AGIGDGKEEWTAVKDDKAALPDETSLAAAKPGSGRPNFSFPDINGKKVSFSDKRFENKVVVITIMGSW
    CPNCMDETGFLS
    EWYKSNKARGVEVIGLSYERTTDFAKSQKALQGFLKRFDVNYPVLITGVTVSDPERTEKTIPQITKIKGFPTTIFIDKKG
    NVREVHTGFSGPGTGEHYETFKKDFNNLVNSLLEEKS

    >gi|256425381|ref|YP_003126034.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chitinophaga pinensis DSM 2588]
    MRSHLFKHTLPVITLLIGSFSAKAQSGAGPFILKGQVAANKYPAVLYLDYEVGDKNWVHDSVTLKDGHFKFTGKLKRPVS
    ARLIFKNQPGYRYFYLQPGTVEVNTSGSLDSAIVSGSPNTAIQDKYAKLRESYSAVFAGFRNRSFFNRGNQDTLDAVKAA
    RAIVEKQYTSTLADFIRQHADTYAAWDIVYNCHIALDPDFITPLFDALSPRLKNAPEGKELATQIANVRRVMEGAPAPDF
    IQSDVKGNQISLSSFRGKYVLVDFWASW
    CGVCRMENPNVLRAYNVFKDRGFTVLGVSLDDSTQHQKWLKAIEEDNMPWQQ
    VSDLKGRNNMAAVQYGIRGIPQNVLIDPNGVIVGKNLRDKELMNKLIEIFDKGYNMRMEGDIKGFKDSIMIFSYNRDNTQ
    VHDTVPVQNGQFNWLALMKEPQAVQAISLPGHHMLRFYSDIGYLQFSAKADSLAAFTLKGSALQDEANFFKASVKTITDQ
    QTEVVMKYYAATSKEAQRPYKAQMKTLQEEYNDRVKQYIQTNFYSLYALQMVKDMAENLAGPEYGEVNPLFMLLPEVVRG
    TPTGKIVAEKMPVIKRQAIGEAVTNFSQIDSTGKNISIADFKGKYVLVDFWASW
    CGPCRAENPNVLKAYDAFKAKGFTVV
    GISLDTDAFKWKKAIHDDHMPWTQLSDLKGWKNEVAQYYGVRGIPWNMLVGPDGKIIAKGLRDEELMSKLSELMQ

    >gi|256425595|ref|YP_003126248.1| hypothetical protein Cpin_6643 [Chitinophaga pinensis DSM 2588]
    MKPLYTCLLMMLWSLAVTAQKKSDPKIIGKAKFLMTEVNFNNLPANKPYVGLIMFINVSKEPLTILEINNECSCFTASPR
    EKVIYPNEKGIITYKVDNPPKGSIRKKSFIRFKEMKEPVGIVVRGRFI

    >gi|256425847|ref|YP_003126500.1| Rhodanese domain protein [Chitinophaga pinensis DSM 2588]
    MIYKYYIYLLFGSILFSVSNRVNAQEVNAVVFNDSIRNGNVQVFDVRTAGEYNTGHLSNALQADYTKKEEFMERVKYLDK
    DKTVYIY
    CLSGGRSAKAASWMRGNGFKKVIELEGGINAWKQAGEPVEGTADVKQMEVDAFRADIGKGEVLVDVGAEWCPP
    CRKMAPVLEAYLSEHKTVRLLKVDGGRDQDVMQSIKVTSLPTFILYKDGREVWRKQGVYEQL

    >gi|256425850|ref|YP_003126503.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chitinophaga pinensis DSM 2588]
    MNVTVGAKAPSFSLLNTEKQKVSLEDFKGQNLVILFFPLAFTSVCTAELCSIRDNIGTYNDLNTAVVGISVDSPFTLGKF
    KAEQNLNFPLLSDFNKDISQAYGAFYENFVLDLKGVSKRSAFVVDKEGVVRYAQVLESAGDLPDFEAVKNTLNGLQ

    >gi|256425978|ref|YP_003126631.1| cytochrome c biogenesis protein transmembrane region [Chitinophaga pinensis DSM 2588]
    MKHLLTFLILITSVFAVKAQDTTTQASVAKWEYTAEKKADKEYILHLKGTVEKDWKLFSTTMKDDEPNTRVAVDSAATIT
    GITEQGTLKKAPEALFDNLEIKYFEGQVTLDVAVKLSGAVTKLEGAVNYMALKGDEVVGPEEVKFRFNVDASGNIVNVAA
    GLQESAVAGQTLKRAAIDMANPLSNCGGADQEPKSLWGLFILGMIGGFIALLTPCVFPMIPLTVSFFTKKSQDKKTGVLN
    ASIYGFFIFLIYVLLSLPFHFLDSLDPEILNNISTNVWLNLIFFVIFIVFAISFFGYFEITLPSGLASKVDAKTSVGGII
    GIFFMALTLALVSFSCTGPILGSLLAGSLSTDGGAMQLTVGMGGFGFALALPFALFAMFPNLLKSLPKSGGWLTSVKVVL
    GFIEIAMAIKFLSNADLVTHWGLVKREVFFAVWIICGFLIVLYLLGKIRFPHDAPLKKISTTRWILAAIFLAMTIYLLPG
    VTNTKYANRQLISGFPPPLSYSLYKNAAKGVEANVVNDYEAALKLAKEQHKPILIDFTGWA
    CVNCRKMEENVWPDEKVKA
    LIEEDYILVSLYVDDRKLLPEDQQFLFTTNTGRKKEIKSIGDKYATMQTENFVNNSQPYYVLISPDEKLLTKPVGYTPNA
    GEYANWLKCGLDAFKKNK

    >gi|256426062|ref|YP_003126715.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chitinophaga pinensis DSM 2588]
    MRMNIKKVSIVAMLAIGCSLFIAAPAAKAQTMQEQHTLAKGENVPEFSLKDQDGKTFNLADVLGKKKLVIFFYPKDESPV
    CTKEACAFRDAYEKYKDADAMVIGINNGTVESHKAFAKKNRLPFTLLSDPDNVVLNKFGVKEQDFGNNVKVSGRETFVIG
    LDGTIVYSFRDFMKGDEHAQQVLNYLSGK

    >gi|256426064|ref|YP_003126717.1| Protein-disulfide reductase [Chitinophaga pinensis DSM 2588]
    MKKLLIIIGCLMHFAAFAQIDNPVHWTFTAAPAGDNKVEISATAQIDEGWHLYSQFLKEGGPVPTSFQFDNAESYHLVDG
    VTESPAATSGYDSTFEMTILYHEKSVTFKQLITYTDPAAQIKGQVHYMVCSGQKCLPPTDVDFEVAVDATVSHAANTAQV
    QKDNAPADKQSPVNDSGSSILSIFLAGFLGGLAAFFLPCIYPMVPLTVSFFTKQSKTRRQGIRAAIIYGCSIIVIYVGLG
    LLITAVFGASALNEASSSAVFNLLFFTILVVFALSFLGAFEITLPSVFVNSIDQKSGKGGWIGLFFMAFALALVSFSCTG
    PLIGTLLVEAVSKGSYLGPATGMFGFSLALALPFTLFAIFPSWLKSLPKSGGWLNSVKVTLGLLELALAFKYLTNVDLAY
    HWGLLSRDLFLVIWIIIFGVLAFYLLGKIRLSHDSEVKTLSIPRLLLSMLALAFTVYLIPGLFGAPLKGISGWLPPQQTQ
    QFTLGAANADKPAGSSTHKYAGLFHAPENIDAFYDYDEGMAYAKKMHKPVLLDFTGWS
    CTNCRKMEAAVWSDPEVLKRLK
    EDYVLISLYVDDRTSLSNTEKYVSKVSSKSINTIGQKWSDLQQERFNTNAQPFYVILDPDGQPTAEPRAFNLDIKAYVDF
    LDMGISSVRKKLTVQLSN

    >gi|256426065|ref|YP_003126718.1| thioredoxin domain protein [Chitinophaga pinensis DSM 2588]
    MRIKLFRSAMLAGCLALIASAYSSRVLAQQKAPQEIKFSSKAYKEVLATAKAAHKKVFIDAYATWCAPCKELRKHTFNDP
    KAAAYFNKNFVNFTIDVEKGEGIALAKTWQVDGLPTLLIVDEKGQVLANHVGFVDGDGLIQFAKEATENIQSKGSKPASK
    R

    >gi|256426066|ref|YP_003126719.1| peptide methionine sulfoxide reductase [Chitinophaga pinensis DSM 2588]
    MKIKQLFNVLLAVALFAALGVHAKSAPNNDTATFATGCFWCGEAKFSQLKGVIKVTSGYTGGRIADPRYSLVSTGTTGHA
    EAFNVIYDSTVITYDELLEAFFLSHDPTELNRQGNDVGTQYRSAIFYHNDAQKERAAYYLNKFTEQHIYPKPIVTELTRF
    TVFYEAETYHQQYYKKHPTQDYCRYVIQPELEKFKLIFKDKLKQ

    >gi|256426067|ref|YP_003126720.1| methionine-R-sulfoxide reductase [Chitinophaga pinensis DSM 2588]
    MKKILIYSALLMLISISSFAQNEKSTRGHENNPWYSNTDTSRLTVSNVEWKKVLPGALYAVAREKDTERPFTGKYWKSTT
    RGTYYCAVCGNLLFRSDAKFASSCGWPSFYEPKRASAVRYQEDYSVGMHRTEVLCGRCDSHLGHIFDDGPAPTYKRF
    CMN
    SVSLDFEPDKK

    >gi|256426070|ref|YP_003126723.1| thioredoxin reductase [Chitinophaga pinensis DSM 2588]
    MLAETEHIKCLIIGSGPAGYTAAIYAARAGLQPVMYTGIEPGGQLTKTTEVENFPGYPTGITGPVMMEDFRMQALRFGTD
    IRYDYVSGVDFSTYPYEVTVDERKKIMADSIIISTGASAKWLGLESEAKYNGSGVSA
    CAVCDGYFFRGKDVALVGAGDTA
    AEEAVYLSKLANKVYMLVRRDEFRASKLMVQRVLNTPNIEVLYNTETLEVLGDGRSVTGIKVYNNQLKQESAIPVTGFFV
    AIGHTPNTAIFSGAIDMDEAGYIKTNPRSTATNIPGVFCCGDAQDPVYRQAITAAGTGCMAALDAERFLNEREAALSFVI
    GDLQQAS

    >gi|256426071|ref|YP_003126724.1| OsmC family protein [Chitinophaga pinensis DSM 2588]
    MCFSATLHQQNITTMRRSSKAHWNGDLSTGHGELTTDSLVLNKTRYSFNTRFADGIGTNPEELLAAAHAGCFTMALTYAL
    SQAGLKVADLDTTAVVTIAPSKGSISDIELTLDASPIEGLSEEAFLEYAIGAKQN
    CLLSKALTGVVISLNVNYKGLHQHI
    DGNAKPVDHVS

    >gi|256426072|ref|YP_003126725.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chitinophaga pinensis DSM 2588]
    MNLKINQPAPDFITRDIWGNTVQLSQLREQKVLLTFYRHVACPVNHLRFQELRTYEKEFCKKKLAVLAVYESSKDNLLRY
    SEDENYYARLIANPEFDLYEKYDIELNTLKLLFSMYNGGPAKAAEGLKLMKHRFKAEGHNNLMGGDFLIGEDGLLKQVYY
    NQFLGDHLPTKEILAFINDPDYKVIGSSTCCD

    >gi|256426073|ref|YP_003126726.1| dihydrolipoamide dehydrogenase [Chitinophaga pinensis DSM 2588]
    MEQFDIVVIGSGPGGYVAAIRAAQLGYKTAIIEKYSTLGGTCTNVGCIPTKALLDSTHHYHDALHKFAVQGINLQGIQLD
    FKQLYKRKSEVVTKNTQGLNYLMKKNKISVIQGLASFKDNSTLQVRGQDGVSRTIQAGKYIIATGSKPATIPGVVLDKKR
    IITSTEALALEERPKTMVIIGGGVIGVEMASIFSRIGTKVTILEYADRLIPTMDSESGITLQKLLTKEGIEILLQQSVFK
    TENTVDAAKVWYKDVAGQEQSLTADYVLVAVGRKAYTDNLGLENTQVQLNPRGMIVVNEVLQTAVPNIYAIGDVIGGAML
    AHKAEEEATFVVERIHGGNPHIHYDRIPSVVYSWPEVASVGASEEELKKKQVAYNVGKFPFSANARARAGMDTEGFVKVL
    ADPKYGEILGVHIVGARAADLIAQAVTAMEFEITVNEMGKISYAHPTYAEVLKEAYILASGQASVNI

    >gi|256426077|ref|YP_003126730.1| hypothetical protein Cpin_7128 [Chitinophaga pinensis DSM 2588]
    MRLYLFFIIVLFFSCKQTNNTANTVKINGHLKDLPDGMLYILNDKQQQIDSTHSDKGQFSFDLPITNNDQYYYVTLEHLD
    DTKVKRLFHFKTNKKYKGNELFLQYFIAEDGLQINGAIEDFTPKDMRLPDNIRLVHLSEFITGAQNTVMNNIDYDFNQPV
    NDSAWDILKTLVRKYPSSYYLIHEINKYRNNYSGNQLKELLASFDENIRQCLEAKTISNAIAIKQSNTKTANNTRLQAID
    KTLQPVIDATASVNMVILWASW
    CAPCIAEIPELQKIYTKYQANSKFRMLSVSLDAEEDKWKNALEKHPMPWTQLWLQQAL
    KEYQQEIFQFDNSIPTIIFFNNKGEIIKKYTGANASNTEQYIHLIDTSL

    >gi|256426094|ref|YP_003126747.1| OsmC family protein [Chitinophaga pinensis DSM 2588]
    MKRTASAIWNGTIKEGSGNISTQSTVLNKTQYSFNSRFAEGVGTNPEELMAAAHAGCFNMKLTLDLEAAGFKADTLETTA
    AVTLDNGTITRSDLALKAKIPGISNEQFQEIAAGAKAG
    CPVSRAYAAIEISLQAELVG

    >gi|256426104|ref|YP_003126757.1| thioredoxin [Chitinophaga pinensis DSM 2588]
    MATFSEIINSDKPVLVDFFATWCGPCKMQAPILDQLKQKVGDAATILKVDVDKNPAAANAYNVQGVPTLILFKQGKIVWR
    QSGVVPASNLEQIVRQNA

    >gi|256426107|ref|YP_003126760.1| alkylhydroperoxidase like protein, AhpD family [Chitinophaga pinensis DSM 2588]
    MKTFNVPSREEVSANNQTLFDNLKKGLGKVPNLYATMAYSENALATYLALSTGKTSLKAKEKEVVNLVVSQVNDCDYCLA
    AHTYIGKLNGFSDEQIIEIRKGSASFDPKLNALAALVKNQVENKGKVDPALVDAFFAAGFTNENLVDVIIVIGDKVVTNY
    LYAATKVPLDFPAAPALS

    >gi|256426114|ref|YP_003126767.1| OsmC family protein [Chitinophaga pinensis DSM 2588]
    MKGMHHYKMTTRWTGNTGSGTSAYQAYERNHILQVDGKPEIPGSSDPSFRGDKTRYNPEEMLVASLSSCHMLWYLHLCSE
    AGVIVVDYVDNATGTMIETADGGGHFSEVTLHPEVTVTDPAMIDKANALHAKANQL
    CFIANSVKFPVHHDAKCKI

    >gi|256426135|ref|YP_003126788.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Chitinophaga pinensis DSM 2588]
    MKQLLAALLLSPGVLLAQKGDFTIKGKIGNLNAPAKLHLVYRTGGVEVKDSAELKDGVFQFKGSIEEPGQAMMVLKHVNP
    PADPRMRDMIVFYVEKGTITLNSADSLKKVTFSGSPLNTDNQQLQESLKSVTTAYQALNGEYMAADEQKRNSPEFQQYLD
    EKLAVIRGQQGDVYKTFIAKHSKSMVSLDVIQQYAYEASDKVGQLDSMLNSLDGSLKKTKNGQELAKLIGSWKATVIGAE
    APLFTQNDTLGKPVNLKDFRGKYVLVDFWASW
    CRPCRMENPYVVAAFNNHKDKAFTILSVSLDQPTGHDAWINAIHKDGL
    AWTHVSDLKFWDNDVAKLYGVKSVPQNFLLDPQGKIVAKNLRGEELDKRLNELLK

    >gi|256419578|ref|YP_003120231.1| electron transport protein SCO1/SenC [Chitinophaga pinensis DSM 2588]
    MSKKNVFYIIFFALLSIAFLGYSGYVIKGEKGSFFGEEKLPILGTNGHIIGGFSFVNQEGKTITSKDVEGKVYVAEYFFT
    T
    CTNICPKMNANMMKVYAAYKDEPRFRILSHTVDPETDSIPVLKKYAEEHGADPSNWWFLTGSKKELYKLARAGYMVDNG
    TFTGDDDFVHTQWFALVDGEARVRGLYEGTKKSDVDKMIVDINRLLKEKQ

    >gi|256420460|ref|YP_003121113.1| hypothetical protein Cpin_1415 [Chitinophaga pinensis DSM 2588]
    MKKYLWLPALLIMLSAGVTYAQEKQHLDLEHIYNPAADAAADLAKAQQQAAAQNKHILIEVGGNWCIWCKRFYKMLHEDT
    TLLSQAENNYVIYYLNYSKENKNLRLLQQLGYPQRFGFPVLLVLDAKGNRLHTQNTGLLEDADGYDKKKVADMLKQWSPQ
    ALNPAFYTNQ