Cellvibrio japonicus Ueda107 uid59139

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|192359080|ref|YP_001980687.1| protein-disulfide reductase [Cellvibrio japonicus Ueda107]
    MLSIRQTNLLIFLGCTALILAAAYMEHVMKMVPCSLCITQRAFVILTGLIALAALIHHPATTGRRAYAVFGIISALLGAA
    FASRQLWLQSLPADQVPA
    CGPGLAYIFEEFPLMEAFKLLLQGDGNCAHVDKIFGMSLAFWTLAAFIGLALVNLYQAIRKA


    >gi|192361228|ref|YP_001980826.1| hypothetical protein CJA_0302 [Cellvibrio japonicus Ueda107]
    MIVKIIGSLLIGMLLTLEATAKPLQLDAQYAVFDGDPVSLQQVLGKQPVYLKFWASWCLDCRRELPHLQQTYERYRDRIA
    FYAVNLNINEEDTYIQALKDKHQLTIPIVMDNNGSIAGNFQFHGTPFHVLINRTGDVVYTTYKDDAQLASNLEQLASLGT
    LATAKNSAQIARTSTPVTLPEGLALVYFATTWCDWYMADIHPDMARNCTQADQLVNQLHKQHPNIPLQSYVSHLWTEEKY
    LKEYIEKFNIRYPVTVDTEGAIARYYQNSEYPTLLLFDKGKELKRFSRFENPEDVLAQLNTLLGKNK

    >gi|192360857|ref|YP_001980884.1| thioredoxin [Cellvibrio japonicus Ueda107]
    MPAWGGVLIIAPVFSGPWPWFNALNPGVFMSSDAIVHISDASFEQEVIAADIPVLVDFWAPWCGPCKMIAPILDDLAEQF
    EGKLKITKLNVDDNKESAAKFNVRGIPTLIIFKNGAAHATKVGALSKPQLVDFINGAL

    >gi|192362524|ref|YP_001980899.1| AhpC [Cellvibrio japonicus Ueda107]
    MASINSEIKPFSAQAYHQGKFIHLTEADLKGKWSVVFFYPADFTFVCPTELGDLADNYADFQKLGVEIYAVSTDTHFTHK
    AWHDSSETIGKIQYPMIGDPTGAITRNFGVMIEEAGLADRGTFVIDPQGKIQIIEINAGGIGRDASELLRKVKAAQYVAA
    HPGEVCPAKWKEGDATLAPSLDLVGKI

    >gi|192360995|ref|YP_001980900.1| AhpF [Cellvibrio japonicus Ueda107]
    MLDAAIKGQLKAYLEKLQRPIELVASLDDTAKSRELKSLLDEITALSDNVSARLDGNSVYRPSFGVARPGETPRIEFAGI
    PLGHEFTSLVLALLHTGGHPARIDAATLEQIKAIDGQFHFDIFVSLS
    CHNCPDVVQAVNTMAAQNPNISATMIDGALFQG
    EVEKRQIMAVPSVYLNGQHFGQGRMTLEEILAKIDTGAAEREAKLLNGKVPFDVLVVGGGPAGSAAAIYAARKGIRTGVV
    AERFGGQVLDTLAIENFISVTETEGPKLAMALEQHVKEYDVDVMNLQKAAELIPGDLIEVKLASGASLKSKSVILTTGAR
    WREMNVPGEKEYRGKGVAY
    CPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVAHVTLLEFDSTLRADAVLQRKLLSLPN
    VTVITEALTSEVLGDGQKVTGLTYKNRNTDDLTQVELEGIFVQIGLLPNTDWLKGTVALSQRGEIEINTRGETSVPGVFA
    AGDCTTVPYKQIIIAMGAGSTAALGAFDHLIRASAP

    >gi|192360392|ref|YP_001980968.1| Selenoprotein W-related family [Cellvibrio japonicus Ueda107]
    MAPVVAIWQPNGAFLLIFAPYAELLHIDRILVTQPIKSNHMSDKNASSPVTPEIPLARNRVVIHYCNLCRWMLRSAWLAQ
    ELLTTFDGELDEVSLHPGTGGVFHVWLNDQLVWDRVRDGGFPEAKELKQRVRDLLCPERSLGHSDGHKKADTD

    >gi|192360933|ref|YP_001981059.1| 2-hydroxychromene-2-carboxylate isomerase family protein [Cellvibrio japonicus Ueda107]
    MPRIDFVADINCPWCTLGFIALDSALARLGQDPAQLVEIQPFELNPQLGADGVNLVEYLSKRHGMGLAQIEDIHQRLRQL
    GEGLGFHFAERERLWNSFDSQRLLHWAAVECPAGSQYALYRALIQAYQGQARNTSDHVVLVELVKSIGLDSDRAAEVLAG
    DEFAHEVRQRQQQWQQAGINAVPSTVINHQQLLQGAQPVAVFEKALQDLLHA

    >gi|192362250|ref|YP_001981174.1| molybdopterin biosynthesis MoeB protein [Cellvibrio japonicus Ueda107]
    MAMNDEQLLRYSRQIMLPDLDIDGQEALLSSHVVIIGLGGLGSPVSMYLAAAGIGQLTLVDFDAVDLSNLQRQIAHTSER
    IGHNKAQSAAQTLRALNPHIALHIHSQRVDSEALAALVAGADLVVDCTDNFTTRFAINAACVAALKPLVSGAAIRLEGQV
    AVFDNRDPQSPCYRCLYEESADDLT
    CAANGVLAPLVGVIGSMQALEAIKVLAPVGQPLAGRVLLFDGRYSQWREMRLRKD
    PCCPVCSVKPCLSE

    >gi|192362288|ref|YP_001981302.1| thioredoxin family protein [Cellvibrio japonicus Ueda107]
    MLLASEFAILRPRTTHLIMTGTPAMKYLMILLLALFANTSTSAPYKTGDTPLDALGKSSLGEEVRISDYYGKVVIVSFWA
    TW
    CGPCMKELPVLGGIQKSATTEQLQVISINYREDRRQFRKIAKALSNTDMVLISDAQGKIGKKFGVEGIPHMVIIGRDG
    KVADVHIGYSEAMLPALVDQINEIARRPAAEPTES

    >gi|192362320|ref|YP_001981396.1| HesB/YadR/YfhF family protein [Cellvibrio japonicus Ueda107]
    MSTPEIYVPQVVTVTDSAVAKVRSLIEEEGNADLKLRVYVTGGGCSGFQYGFTFDELVAEDDSVVERGGVKVVVDAMSYP
    YLAGAQVDYEEGLQGSKFVIQNPNASSTCGCGSSFSL

    >gi|192362439|ref|YP_001981439.1| putative glutathione peroxidase [Cellvibrio japonicus Ueda107]
    MTSPFFQFTADSLAGQPVSLADYSGRWVLVVNTASQCGFTPQYAGLEQLYQKYRDKGLVILGFPCNQFGGQEPGDASDIA
    QTCQVNYGVTFPMFAKIDVNGADAHPLFHWLKAALPGLLGQSIKWNFTKFLLDPEGKPVKRFATVTKPEAIDRYLQAKIR
    SQHSSTARAGE

    >gi|192362170|ref|YP_001981499.1| electron transport complex RsxE subunit [Cellvibrio japonicus Ueda107]
    MSDVSYREITAKGLWSNNPALVQLLGLCPLLAVSSSVVNALGLGIATLLVLVISNSFVSLIRRQVSDAVRLPAFVMIIAS
    AVTCTELLMKAFTYELYQILGLFIPLIVTN
    CAVLGRADAFASKNKLIPSAVDGFMMGLGFMLVLVAVGAVRELLGTGHLF
    GDMHLIFGEGARSWQLNIFGADYPNVIFALLPPGAFIVVGMLIAAKNSIDAHLKKRADARKTAVSTGSKRVRTTGAVS

    >gi|192359743|ref|YP_001981504.1| RnfA-related protein [Cellvibrio japonicus Ueda107]
    MSFSEVAVILLSTVLVNNFVLAQFLGLCPFMGVSNKLESAIGMAGATTFVMTLASICTYLVSSWVLAPLGLDYLRTIAFI
    LVIAAVVQFVKMFMEKTSPLLYRVLGVFLPLITVN
    CAVLGVALLNVQKTHNFIESTLYGFGGALGFAMVLILFSAMRERL
    AVADVPTPFRGASIGMITAGIMALAFMGFSGLVSLQ

    >gi|192361205|ref|YP_001981563.1| probable peroxidase [Cellvibrio japonicus Ueda107]
    MGVLVGKKAPDFTAAAVLASGEIVDGFNFAAATKGKKAVVFFYPLDFTFVCPSELLAFDHRVEEFKKRNVEVIGVSIDSQ
    FTHNAWRNTPVNEGGIGPVKYTLVADVKHEIAKAYDVESADGVAFRGTFIIDEQGVVRSQIVNDLPIGRNIDETIRTVDA
    LIFHQEHGEVCPAGWKDGDKGMDASPAGVAKYLAENADKL

    >gi|192360728|ref|YP_001981597.1| Protein yffB [Cellvibrio japonicus Ueda107]
    MTILYGIKNCDTVKKARNWLEQHGIDYQFHDFRTDGLSETQINHWIRELGLEQLVNKRSTTWKALDDASKAAFSESTAPK
    IIAANPTLIKRPLLDTGSHKQLGFKEAEYQQLFS

    >gi|192359317|ref|YP_001981816.1| phage shock protein [Cellvibrio japonicus Ueda107]
    MLRAFSRLIGMLLLMVSTLVMANEIWIDVRTPDEYNAGHLHGAILIPYEEIAARISEVTSDKNARIRLYCRTGRRSGIAQ
    ETLQALGFTQATNEGGYEDLLRAGHQ

    >gi|192361175|ref|YP_001981927.1| thiol:disulfide interchange protein DsbC [Cellvibrio japonicus Ueda107]
    MINILKNTGFLTGCALVSLVSFLAVPAAVAQEESSSGTLLKRKGPEEVILENLHKARPEIKFGKPRPSPIKGLYQVQVPG
    GPILYVTPEGDKLIAGELLAIEEGGLVRVEDPYLIAERKKMVSSIDPKSTINFKPKGKAKAVVYVFTDVD
    CGYCRRLHSQ
    MHTYNENGQQLPGYNDLGIEVRYLAYPRAGIPSPSADKLISAWCAKDKQDALTKLKAMEAVPNATCDNPVATHFQLGGEA
    GVSGTPALFFPDGKLIPGYLPPAELAKQLGI

    >gi|192360534|ref|YP_001981930.1| thioredoxin-like protein [Cellvibrio japonicus Ueda107]
    MNIVDINLENAKSYLIDESFQRPVVVDFWADWCGPCKSLMPILEKLANEYAGAFLLAKVNADDQHMIAAQFGVRSLPTVM
    VMKDGQPVDGFAGALPEVKVRELLAKYLPQPWEAPLNDAKALMESGQYAEALPLLREAYDASQQQAAIALLMAQCHLELN
    RIDNAETVLETIKMADQDGFYHQLKAQIELKKQAAKTPELAALEAAHTQAPEDLSIRYQLAVQLHQESYHRPALEHLLEI
    LRKDRNYAEGEARKTFTAIIASLGKGDPLAIEFQRRLFTLLY

    >gi|192358912|ref|YP_001981958.1| HesB protein [Cellvibrio japonicus Ueda107]
    MSIQSFDPQQQSLQQAVLVTPAAAAHFKRQLEKSQGASAVRLSVKQSGCTGWKYVVDLVKQAKEDDLHLPLETGVELLVA
    QDALPVVSGTEIDFVIEGVNQQLKFNNPRVKDYCGCGESFSVN

    >gi|192361694|ref|YP_001981993.1| dihydrolipoamide dehydrogenase [Cellvibrio japonicus Ueda107]
    MSEKFDVVVIGSGPAGYVAAIRAAQLGLKTACIEKWRNEEGKGVNGGTCLNVGCIPSKALLDSSYKYHEAKDDFAVHGIT
    ASGVEINVPAMVARKNQIIKNLTGGIAGLFKANGVTSVFGTGKLLAGKKVEVTDHEGKVSVLEANHVILASGSSPINIPV
    APVDNDVIVNSTGALEFQSVPARLGVIGGGVIGLELGSVWNRLGSKVVVLEALDTFLGIMDQQIAKEANKILTKQGLDIR
    TSSRVTGSEVKGKEVTVTYTDKDGNEQKETFDKLIVCVGRRPYTENLLAADSGVNLDERGFIFVNEYCETNAPGVWAIGD
    VVRGPMLAHKGSEEGVMVAERIAGQKSQMNYDIIPSVIYTHPEVAAVGKTEEQLKASGEPYNVGTFPFAASGRAMAANES
    QGLVKIIAHAETDRILGCHIVGPSAADLVQQVAIAMEFGSSAEDLGMMVFGHPTLSEAIHEAALAVHGHAIHIANKKKR

    >gi|192360547|ref|YP_001982114.1| putative ADA regulatory protein [Cellvibrio japonicus Ueda107]
    MTPQPTDSPDPRWHLLNDASAEGQFFYAVITTGIYCRPGCPSRRPNPDNVRFFPSPDAAQAAGFRPCKRCHPQRDTPDSL
    IQERITALCRFIENADGEPSLQEMANYAGLSRYHLHRLFRQVTGLTPKAYAKASQQGANQHHNPYRGKLPMNIEFALDHS
    SLGLVLVARTEKGVCAILLGDQEDTLVEDVQRRFPHASLHASRQLAKELAAIIAYIEQPSRTLDLPLDIRGTLFQQKVWQ
    ALREIPAGETRSYKAIAGHLGSPDAVRAVAGACAANPLGLAIP
    CHRVVRSDGGLSGYRWGVERKRELLKREAKAAGKNP

    >gi|192360325|ref|YP_001982138.1| Bcp [Cellvibrio japonicus Ueda107]
    MSFPTIGKAAPAFSLKNQFGETVSLSQFKGKKQVVLYFYPKASTPGCTTQACGIRDTHTEFDALDTVVLGVSPDNPAKLK
    KFDEKYQLNFSLLADEDHSIAEAYGVWGLKKFMGREFMGILRTTFVIDKQGKVRQVIDKVNTKTHDQDLLDILRAGM

    >gi|192359860|ref|YP_001982144.1| dsrE protein [Cellvibrio japonicus Ueda107]
    MARFSIAVYAPPQTNQTSFSAWQFAQSVLAQGHELYRVFFYMDGVHNADSVITPPQGEPNLVTQWQTLAQNHGTDLVVCI
    AAALRRGVLNEEEAKRYRKHNHNLAEGFSLSGLGQLVEAIALSDRLIVFGN

    >gi|192361593|ref|YP_001982245.1| Na(+)-translocating NADH-quinone reductase subunit D [Cellvibrio japonicus Ueda107]
    MSVKAKELLTKPIIENNPVILQILGICSALAVTSSVKVSLVMAIGLTLVSAFSNFFVSLVRNYLPSSVRIIAQMIIISAL
    VIVVDQVLKAVAYDISKQLSVFVGLIITN
    CIVMGRTEAFALKNPPVPSFLDGIGHGLGYSALLIVVATFREILGAGKWFG
    IQILPTVSEGGWYVPNGLLLLPPSAFFLIGLIIWVLRTWKKNQVEKASFTMAPNSVKTQEIA

    >gi|192361014|ref|YP_001982246.1| NADH:ubiquinone oxidoreductase, Na(+)-translocating, E subunit [Cellvibrio japonicus Ueda107]
    MEHLLSLLVRSVFIENMALAFFLGMCSFLAMSKKINAAIGLGIAVIVVQTVTVPANNLLLTYLLKEDALAWAGVTGVDLT
    FLSFISFIGVIAAIVQIMEMVMDKYMPALYNALGVFLPLITVN
    CVIMGGSLFMVERDYHFAESVVYGFGSGAGWAIAIVL
    LAGILEKMKYSDIPEGLRGLGITFITVGLMSLGFMSFGGISL

    >gi|192361161|ref|YP_001982249.1| soluble pyridine nucleotide transhydrogenase [Cellvibrio japonicus Ueda107]
    MADHSYDLLVIGSGPSGESAAIAAAKIGKRVAVIENRAVVGGSCAHKGTIPSKSLRHVVKQIIQFKANSLFREIGDSRRL
    TFPRVLASAARVIPKQVELHTNFYVRNRVNVHIGQASFIDKNTISLAMLDGGRETINASKIVIATGSRPYRPDDVNFAHP
    RIYDSDTILGMEHTPRHIIIYGAGVIGCEYASIFSGLGMRVDLINNRERLLSFLDDEISDALSYHLRDSGVTVRHNEEYE
    SIEANASSVSLNLKSGKRLKADAILWCNGRTGNTDSLNLAAIGLEADHRGNLKVDNNYCTSVDNIYAVGDVIGWPSLASA
    SYGQGRAVTAGIFGDECRLVTDVPTGIYTLPEISSIGKTETELTRARVPYEVGRALFKNTARGQISGEDVGMLKLLFHVE
    TLEILGVHCFGAEAAEIVHIGQAIMNQESEGNSIEYFLHTTFNYPTMAEAYRIAALDGINRINRR

    >gi|192361707|ref|YP_001982288.1| hypothetical protein CJA_1813 [Cellvibrio japonicus Ueda107]
    MKTLYLYTTSGCHLCELATDILWPLLDELGWHLEEQDIADSDVLIERYGMRIPVIAAAGVQGAEELGWPFDQQQARAFLQ
    RMDNH

    >gi|192358884|ref|YP_001982310.1| periplasmic metal-binding protein-related protein [Cellvibrio japonicus Ueda107]
    MTTLLVKNMTCGSCARHITQAVKALDPDAQLTIDIPARKVSIDSTQPVGDLVKAIEAVDYEVAVASE

    >gi|192361046|ref|YP_001982311.1| copper transporter [Cellvibrio japonicus Ueda107]
    MIDSTTTDYDLPIEGMTCASCAGRVEKALRAVPGVEDAAVNLATEKAHIRTKGHTDAKVLQTAVERAGYTVTAAETTLGI
    EGMT
    CASCVARVEKALRAVPGVIDATVNLATEKAHINALPGISRASLVSAVQKAGYDVRPENPFTAPAVAEPARWWTVLE
    TRHLVLATILSFPLVVPMLLSVFGVHLTIPGWIQWALATPVQFWLGARFYHAGWKALKAGSGNMDLLVALGTTAGYGLSV
    YQLFSAHAAHGESHFYFEASAVVITLVLLGKWLESRAKHQTAAAIRALQALQPATAWVRVDGREIETPIEQVMPGDQVVV
    KPGERVPVDGVILEGQTHMDESMITGESLPVTKQPADTVTSGAINAEGLVVVETQAVGAETTLARIIRLVENAQAAKAPI
    QRLVDKVSAIFVPVVIVIAAATFIGWWWYSGDVQQAIINAVAVLVIACPCALGLATPTAIIAGTGVAAQHGILIKDAEAL
    EIAHRVSTVIFDKTGTLTLGKPRLTAYEAMNGDHQNLLRLSAAVQHGSEHPLAKAAITAAGEQRLQVPSANNHTALAGRG
    VSAQVEGTLLNLGNTRLMDELAIDLSPLKARAASLEAQGNTISWLARVGDYRELIGLLAFGDEIKLEAQAAVNELHRHHI
    NTVMITGDNQGSASSVAATLGIQDFVANVLPADKAAAVSRLKAQNAVVAMVGDGINDAPALAAADVGIAMATGSDVAMHT
    AGITLMQSNPQRVVDAIDISRRTYAKIRQNLFWAFIYNLVGIPLAALGLLSPVIAGAAMAFSSVSVVTNALLLKRWQPRS
    SEKHSSSAQ

    >gi|192361088|ref|YP_001982364.1| possible hydrolase [Cellvibrio japonicus Ueda107]
    MIQLQKATDGKYRQQISIRTHHIYADVSQALGGEDSAPSPHDLFDTSLMSCTAITLTMFAQRRGMPLESINVQLTRDDSQ
    EKQGDYGLSMALDFVGPLTDEQRQQLFAIVEKCPIHKLMSHGRIQIRTQLKG

    >gi|192361875|ref|YP_001982365.1| glutaredoxin NrdH-related protein [Cellvibrio japonicus Ueda107]
    MPYLSSIDKQQGNRMKKYLFLLVALGVFLNWHKIRDEFAPPPDFSAAHEEGVVLYATTWCGYCAKTREFFKKHNIAYVEY
    DIEKSTEGRAQYDQLRGSGIPLVMIDGEVLRGYNPSKMKQLLNIQ

    >gi|192362138|ref|YP_001982411.1| thiosulfate sulfurtransferase [Cellvibrio japonicus Ueda107]
    MNRLITASELKQHINKGAIIFDCRFRLNDPDWGRQAYRQGHIPGAFYLHLNEDLSSPVQAHGGRHPLPQWQTLVHTLNRA
    GVTPQSSILLYDDARFAYAARAWWLLKQIGLHDVALLDGGFEAWVAMGGALDRREPNPRAGNLKIASITAAIRERTDIIA
    NGDQYLLIDSREPKRYRGEEEPIDPVAGHIPGALNFPWQEVTDDKGFCKPVEQQQARWQTANTSKEIVVY
    CGSGVTACVN
    LFSLELAGIPATLYPGSWSDWCSYTDAPIATAE

    >gi|192361277|ref|YP_001982489.1| copper-translocating P-type ATPase [Cellvibrio japonicus Ueda107]
    MGWRKSRMANTATEASLDLHIEGMTCASCVGHVERALSRVVGVTGVNVNLATERAHIELADGTDTAGITPQLISSVEKAG
    YDASLLTTDATAIDDKEEERNNLQRQLWIAALLTLPVFLLEMGGHLIPALHHWIIATLGNNHWIIQAILTTWVMFGPGQV
    FYRKGLPALFRLQPDMNSLVALGSLAAWGYSLVATFKADWLPAQAVHVYYEAAAVIVTLILLGRLLEARAKGRTSEAIRQ
    LIKLQPHKAQRLRDGQPEEVDVTALKPGDVVLVRPGERIPMDGQLLEGQSYVDESMMTGEPLPINKKAGDNLIGGTLNTT
    GSLTYRLTHVGKDTLLARIIQLVEQAQGSKLPIQAVVDQVTRWFVPAVMLIALVTFAVWLAVGPQPALSFALVNAVAVLI
    IACPCAMGLATPTSIMVATGRAANLGILFRRGDALQTLAEVRVIAFDKTGTLTQGKPELTDFIVADGINSAELLALAAAA
    EQHSEHPIAQALIKAAAAQALTLPRLLQFEAIPGFGLKAKLETPAGEQILYIGADRLMVHIGLAIDSLSANAERLAHEGK
    TPIYLAVNGRVAGIMALADTIKPGTREALDTLHQLGYKLAMVSGDNTRTAQAIARQLGIDDVVAEVLPEQKVNVVKTLRQ
    RKGKIAFVGDGINDAPALAEADVGLAMGTGTDIAIESADVVLVRGDVNAVAQGLGLAQATMRNIKQNLFWAFAYNVALIP
    LAAGLAYPVLGILLSPVFAAGAMALSSVFVVTNALRLRSWRAT

    >gi|192359736|ref|YP_001982494.1| possible msrA, pms peptide methionine sulfoxide reductase [Cellvibrio japonicus Ueda107]
    MITQCIIDLFLCFIMFIFWCSTNIDSFMWRNFYFLVRKMRGVHNEDAKFSCYQLVTNPPISNSNQRIYWRLENVMLKARL
    LLILLVNSWLLGAYAQAEPKDMPATRNLDTIVVGAG
    CFWGVEKRFEAIKGVVDVVAGYADGKGIEPNYRAITQYTNKHNP
    NNHAEVVQITYNPTVISLDVLLQRYFEMHDPTQLNRQGNDVGTQYRSVILTNSEAQAGIAQQVLIAYQVLLTKAGYGAIT
    TQIKSLVKFYPAEDYHQDYLAKKPNGYCPDHSTGVRFEDNIKSIPMVDNTALLNGKHILVIDAEDFCPYCKKFKEDVAQG
    YKGDIPMHFRYATQLNGLVLKTPTWATPTILLVQDGKEVFGRQGYMSPEQFYLLLGKFKLGDSEAFNVAFEESTDARFCK
    QYEIFKNTPDGIFVDKLSGAPLFDTRDRFDSGTGWLSFTKAVDGAVIEKPDNSYGMRRTEIRAKVSGIHLGHVFDDGPNG
    KPRY
    CINATVLDFVAR

    >gi|192361568|ref|YP_001982508.1| protein-methionine-S-oxide reductase [Cellvibrio japonicus Ueda107]
    MLFNTTKMIMPTREQALPGRAEPILVDDRHAVKLVSIKPPFPVGMEQIILGLGCFWGAERKFWQQPGVYTTAVGYSAGYT
    PNPTYEEVCSGLTGHNEVVLVVFDPEQVSLGQLLKVFWEAHNPTQGMRQGNDRGTQYRSGIYYFTEAQRELAEATRRDYQ
    SALNENGLGEITTEILPASEFYYAETYHQQYLHKNPGGYCGLGGTGVCLG

    >gi|192360455|ref|YP_001982528.1| Uvs015 [Cellvibrio japonicus Ueda107]
    MNKQRLMLFAPLLVFIVLALFFWRGLSLDPNAMPSALLNKPVPAFKLPILPADENPAGIKEMDESVFKGKISLINVWATW
    CVTCREEHEFLNSLRTQGVAIFGINYKDDSTAAQKWLRDLHNPYVMSAMDEDGRLGLNLGVFGAPETYIVDQQGIIRYKH
    IGAVDAQVWERDLKPVMDALTR

    >gi|192361025|ref|YP_001982546.1| cyclic nucleotide-binding domain protein [Cellvibrio japonicus Ueda107]
    MAISLDVLSSFTPFNTLSHEYLVQVAEKAVLREFPKGSIIFKRGRPFPEKLYLLSGTVDLIDSAFQIATLNPSSESRRSP
    LNMSQPTQVSAVAKSPVTLLAVDSDFLDLVMAWSESGDGQNAANDTLVGSDDDNDWMSALLQAPLFTKLPPANIRQLFLR
    FSTQKVQADEIVIKQGERGEFFYVLESGSAVVLDTSGQILAALRPGNYFGEEALVGDTTRNATIKMLTPGKLKVLKKEDF
    RELLQQPVQKFITVEQLKHPPENITYQIVDVRLSLERRFAAVPGSRNIPLNQLRAQLRELDSGMVYVVTDDSGRR
    CDVAV
    QLLTQAGLDTLILQNADQYYAGL

    >gi|192358835|ref|YP_001982641.1| cyclic nucleotide-binding domain protein [Cellvibrio japonicus Ueda107]
    MVDFDINLTRSLVPLKDMSEAHLLALLDDVVPEVACAGQTLFSEGSYDDQHVYLLHGNVSLVAPDGQRQAIKGRESLFPI
    AHHQPRRVTAIADSDCSLLRINSERLDKMLAWSQVADYLQLLISRQRDLDEDVDWMMTVLKSNLFFKVPPLNVEEIFSCL
    TPQVVYAGDVVIRQGELGEQCYFIKEGEADVTRHVDGNREHLATISVGRCFGEDALVNETVRNATVMMRTDGVLMRLEKQ
    DFYKLLKEPQVATLALAELEAALATHVCVDVRSEEEYTQAHLPRAVNVPLNILAIKSRLLSKTQPTIFY
    CDTGRRSRAAA
    HLLSQQGYKAWALADCADLLEQSKYASYWLDSNNYLLRDGVAVPSD

    >gi|192361374|ref|YP_001982665.1| rhodanese-like domain protein [Cellvibrio japonicus Ueda107]
    MFVQKTNAYNARPVKGCSCGLNVSPDFTYLKLILFMSQIVVAALYKFVKLPDYQEIAPRLRDCCDQLGIKGTLLLAEEGI
    NGTVSGSREGINGLVRFLDADGRFKGMSYKESFHEDKPFYRMKVKLKKEIVTMGVNGIDPQKIVGTYVKPQDWNALISDP
    EVMVIDTRNSYEYDIGTFEGAIDPRTTSFREFPAYVANHLDPAKHKKVAMF
    CTGGIRCEKSTAYLKEQGFDEVYHLEGGI
    LKYLEEVPEQDSLWRGECFVFDNRVAVNHQLEKGIYDQCHGCRHPITEDDKKSPMYMLGVSCPRCYNLLSEEQKTRFGER
    QKQIELAKARNEVHIGALPPERQLRSLRKKDLREEQRRMSLQPMEAKG

    >gi|192361302|ref|YP_001982701.1| Rhodanese-like domain protein [Cellvibrio japonicus Ueda107]
    MTVIPLNHTVESPTPEEKKSGESEIPAILLAATQEALNSELGYAGTVNPEDAWKLFVGGQAHLIDVRTSEERKFVGHVPN
    TLHIAWQTGPALIKNPRFLRELENKLPRDAAILLL
    CRSGKRSAAAAIAATKAGFTRVYNVCEGFEGDLDDNQQRGRISGW
    RQRGLPWVQD

    >gi|192360117|ref|YP_001982746.1| arsenate reductase [Cellvibrio japonicus Ueda107]
    MITLYHNPRCSKSRDALALLRAKGQEPEIVLYLETPPTAKQLKALLKKLGISARELLRKGEDAYQELNLSAPGLSETALI
    EAMVSNPRLIERPIAITGDKAVIGRPPENVLSLV

    >gi|192358788|ref|YP_001982806.1| Rhodanese-like domain protein [Cellvibrio japonicus Ueda107]
    MCYSKTSSYMDIKKHYFIFNDDGPTVLTEFLRYPLNPLKEKIMSIYKYISYGLGVVLVSMSAAAQAASEYLVSTEWLEKN
    LNNKNLRILEVSVDPGQFERGHIPNASNINWHTDLVDPVKRDIASRENFEKLLRNAGVNQDSTVILYGDNNNWFAAWGAW
    VFDVYGVKNVKLLDGGRKKWESESRPLSVKVASTKPGNIKVADANQALRAFLPDVVSVATQENPATKLVDIRSPDEYNGK
    IFAPAGVQELSVRAGHIPGAVNVPWGQAVAEDGTFKSPEELRKVYAAVGIDGTKPIITY
    CRIGERSSHTWFALKKILGYD
    VKNYDGSWTEYGNAVGVPVANVAGTVWGGK

    >gi|192361306|ref|YP_001982807.1| hypothetical protein CJA_2346 [Cellvibrio japonicus Ueda107]
    MAFLLSPGVLTRGLALLVASLLIGASWYLANLHERELSLALLLGALFGFVLQRSKFCFFCITRDFVAQRNSLGLLGLVAA
    LATGILGYSAVYGAILPTPVEGRLPPDAHIGPVSWVLVFAALVFGSGMSLSGS
    CISAHLYRLGEGALASAVALIGVILGF
    ILGFATWNDLYLRFIQEAPVVWLPHYWGYGGALLIQLGLLGFIAWLLVKHHRTVDTQHTPVSFFTAWFVNRWPTYLGGML
    IGSLATVAYFRIAPLGVTAELGSLARTLGSEANILPSRLEGLDSFSGCATAIKETLLSTNGVFIVGLVFASFAASLFSGQ
    FAFDLPDLRKVLRHFVGGILMGWASMTALG
    CTVGTLLSGIMAGALSGWIFAVFCIIGLWLTLKLRTRIAWLK

    >gi|192360482|ref|YP_001982813.1| antioxidant protein LsfA [Cellvibrio japonicus Ueda107]
    MSLRLGDEAPDFVQESTQGTISFHQWLGDGWGVLFSHPADFTPVCTTELGLTAKLKDEFSKRNVKAIALSVDPVDSHNQW
    INDINETQLTQVNFPILADADRKVSSLYDMIHPNANATLTVRSLFIIDPAKKIRLIITYPASTGRNFDEILRVIDSLQLT
    EHHKVATPGNWKPGEDVVIVPALQDADEIARRFPKGYKAVKPYLRLTPDPRI

    >gi|192362203|ref|YP_001982833.1| methionine-R-sulfoxide reductase [Cellvibrio japonicus Ueda107]
    MSDNEKFNDALWREKLTPEQYRICREKGTERPFTGEYWQEFRPGRYHCRCCGELLFDADTKFDAGCGWPSFYTPATKTAV
    REQLDTSHGMYRTEVLCRRCDCHLGHVFTDGPEPTGLRY
    CINSASIVLDSEQVSFTPSTL

    >gi|192359288|ref|YP_001982904.1| thiol peroxidase [Cellvibrio japonicus Ueda107]
    MATVTLKGNPFNTSGELPATGSKAPAFKLVKTDLSEVSSTDLAGKRVVLNIFPSVDTPTCATSVRTFNAEASKLDNTVVV
    CASQDLPFALSRFCGAEGLNNVVPASAFRSDFASAYGVKLVDGPLAGLTARAVVVLDTDGTVLHAELVSEVAHEPNYDAA
    LKALA

    >gi|192362213|ref|YP_001983021.1| thioredoxin-disulfide reductase [Cellvibrio japonicus Ueda107]
    MSDVQHHRLIILGSGPAGYTAAIYAARANLKPVVITGMQQGGQLTTTTEVENWPGGPHDLQGPDLMVQMQQHAERFNTEI
    IFDHIHETQLTERPFKLIGSNTYTCDALIICTGASAQYLGLPSEEAFMGRGVSA
    CATCDGFFYRDQKVAVVGGGNTAVEE
    ALYLSNIASEVTLIHRRDKLKSEKILQDKLFAKEASGNIKILWNHQLEEVLGNDSGVTGLRLKSTQDGSHQEIDVAGVFI
    AIGHKPNTDIFEGQLDMHNGYIKVKSGLEGNATATNIPGVFAAGDVADHIYRQAITSAGAGCMAALDAEKYLDDL

    >gi|192361916|ref|YP_001983073.1| hypothetical protein CJA_2613 [Cellvibrio japonicus Ueda107]
    MTLRSLAHLRFDNRLVRELPADPVVENYRRQVTGAVYSRVTPTPVSAPQLIMAAQDVADLLDLGADILAQPEFTQVFAGN
    SLLPGMEPHACCYGGHQFGNWAGQLGDGRAINLGEVINQRGEHWTLQLKGAGPTPYSRTADGLAVLRSSLREFLCSEAMH
    HLGVPTTRALSLVTTGELVRRDMFYDGNPQWEPGAIVCRVAPGFTRFGNFEIFSARGDIDLLRQLVDFTIRADFPALLEG
    NTPDKHTYLRWYQDVCKRTAQLMAHWMRVGFVHGVMNTDNMSILGLTIDYGPYGWLEGYDPDWTPNTTDAQGRRYRYGNQ
    PRVALWNLAQLANAIYPLINEVEPLQAGLEYFRAQYEACSQQDMAAKLGLSQFRQETDQPLVESLLAVLQSTEMDMTIFY
    RRLASIASVDLLDASNEYLLTHFLPACYQTPDATQVAMLRQWLMDYARRIQQDVVMNGWTEVQRCALMNRTNPKYVLRNY
    MAQQAIDKATQGDYNEVQQLLTLLRNPYDEQPEFDRYFAKRPEWARHKAG
    CSMLSCSS

    >gi|192360364|ref|YP_001983088.1| cation-transporting P-type ATPase [Cellvibrio japonicus Ueda107]
    MENARDTSAECACYHCGLPVPPASYYPVRIQGDLKRMCCPGCQAVATAIVEGGLESFYQFRSQSSERPDSGERGLASWKI
    YDLPEVQSEFVVPLDANLRQANLLLEGIT
    CAACSWLIETHLKKFPGVRSVTVNVSTHRCTLIWDADTPLSTLFAALVDIG
    YTPRPATDEQQQQLIKKENRISLMRIGVAGFGMMQAMMVAVGMYTGATDFWLDFLRWLSMLVATPVVFFSAWPFFQAAWR
    SIRMRQLVMDVPVALAIGLAYLASVWATITSTGEVYFESVSMFTFFLLLGRYVELRARHRNRLAFGNLAQLMPLTACCIR
    EENGCEIEQNLPLKTLNAGDMILVKPGETFPCDGRVLAGESAVVEALLTGESQPVSKKPGDMVIAGTLNHHSPLKVEVIA
    LGAATQLSAIERMASQAADEKPQQVLIGDRIARFFIARLLVVCTVVFAFWLWYRPGDAFWITLSVLVVTCPCALALAMPA
    ALSAATANLRQRGFLVARGHVIETLTQVNRVIFDKTGTLTRGKFAVERVISLADGEPQHGRLLALAAALEAGSNHPLAMA
    FHAWRDQCQAEQVKQLTAAGVEGVIDGLRYRLGTPAFAAELGSLVVPDMPDGYHTWLLLGSETQLLAWIGLVDEARAEAK
    PLIERLKARGIAVELLSGDQSGAVAQLAAHLGIETFRAGATPGDKLSRLGQCQAAGDKVLMVGDGINDVPVLAGADVSVA
    MACSSDLAQTRADAVLLNDHLLVLADAIALAHRTQRVIKQNLRFSLVYNLLALPLAAAGFVPPWLAAMGMTASSLVVIFN
    ALRLKH

    >gi|192358914|ref|YP_001983118.1| OsmC/Ohr family protein [Cellvibrio japonicus Ueda107]
    MQAVVKWVDGAQFLGESGSGHAVLMDGPPDHGGRNTGVRPMEMLLLGLGGCSSFDVMSILTKARQQVTDCRCELEAERAD
    GVPSPFTKIHMKFIVTGTALKEAQVKRAVELSATKYCSASIMLEAGGVEITHSYEIHSAD

    >gi|192361322|ref|YP_001983197.1| c-type cytochrome biogenesis protein [Cellvibrio japonicus Ueda107]
    MTPIATTSESCSSKSAYNSTCRRWIYSLAILWLATCACLVQAQDLLAPKSSPLGSNLLTQQDEFLPVDEAFVPSYRIAQG
    KLLLHWDIADTYYLYEERFKFRSPDGVSLTPVYTPGKMKYDELFERETMVHYYQVTAAFDLGTQRERFTLNLEYQGCADA
    GLCYPPQKRRLAIDPVAQTASLDNSTPVQASPITSPPAADTSTPTAASGWLLQAILFAILGGAILNLMPCVFPVLSIKVM
    SLAAADRRRLGLHGWIYTLGIVLCFVAFAIALLVARTGGEAIGWGFQLQSPGLIAALTYLFFVMGLSMSGLVHFGSGLMG
    AGQNLTQKSGLSGSFFTGVLAAVVASPCTAPFMGAALGFALTQPAYVCIAIFAALGFGMALPLLLLCYMPVLAQKLPRPG
    AWMDNLKQFLAFPLYLSAIWLLWVYGRQTGTTAMAALCAGALAIAFACWLYGRHAQGLTQMLRRVAIVLSLATALWLPYK
    ELHPSAAQAGDHWQAYSPELLQSLRDQGRPVFVNLTADW
    CLTCLANERVTLDTDTVKTLFAEHQVAALKGDWTNTDPQIT
    QLLQEYGRSGVPLYLWFPADRPGKADVLPQLLTKDHLIQAVTHAN

    >gi|192362108|ref|YP_001983300.1| glutaredoxin homolog [Cellvibrio japonicus Ueda107]
    MDVLETIKQQIGENPVILYMKGSPNAPQCGFSMRASQALMACGQRFAYVDILSNPEIRSELPKFANWPTFPQLWVNGELI
    GGCDIITEMHEKGELKPLIDAAVAG

    >gi|192360611|ref|YP_001983573.1| rhodanese [Cellvibrio japonicus Ueda107]
    MPLPFIMEPTELAALLAQPCGKLLILDLGAEQTYRTGHIDGAVHVPAQKIVCAQPPVPGKIASKEQLEKLFSFLGLTPDT
    HVVVYDDEGGGWAGRMIWTLDAIGHKQYSYLNGGLHAWMASGQSLTTEVPVVTPTQVNIKIDPKVVIEIPDILGEMDRAD
    FVVWDARSPAEYSGERITAQKNGHIPGAINCEWTNLMDPNQALRIRTDARDYVTALGFTPDKRIITH
    CQGHHRSGFTYLV
    GKALGLNIRAYHGSWAEWGNHPTTPVVQTE

    >gi|192360339|ref|YP_001983612.1| hypothetical protein CJA_3158 [Cellvibrio japonicus Ueda107]
    MKLISRHLKPWAGFLAMSVSSLLFAPLVLAEAVPGKPAPDFSLEDANGKNHALADYKGKWVVLEWFNKDCPYVKKHYGSN
    NMQSLQAKYGEQVEWLTIISSAKGKQGYLEPAQAVKVKADHNMVSEALLLDPSGATGKAYGAKTTPHMYIINPDGQVVYA
    GAIDDNDSANPAVIPTSKNYVAAALDEALAGKPITTASTRPYGCSVKY

    >gi|192362247|ref|YP_001983613.1| thiol-disulfide interchange protein DsbD homolog [Cellvibrio japonicus Ueda107]
    MRVKGFYRMGRLCVWLLGWLLISVAGLCRAEPVIDADHVRISWLAPSQMGLASSQKTLGILFEVDPHWHVYWRNPGDSGA
    APRFDWRGNYASVSEPLWPFPARLPVAHLTNLGYEGDVAYLFQLVLPETPDEHLEVRVDLEWLVCQEECIPGFGSLSLQV
    PLVDGRDVWDSASESLLAHFKARVPLVVDDGQAQVPWQLAKAVVSNGNRTLALHLHSADANAPEPQVYPLDGAFVTAAAP
    QTVNKGMERILTFTLEPAAPVPEHLGFVAVSGDRAWEWSAVSLTVGGEIVNPVSEPLWWLLLLAFAGGVLLNLMPCVFPV
    LSIKLFSLMKTREAALALRVREGLLYSAGVLATFALLGLSFLLLRAAGAGIGWGFQLQSPWIVLGLAILFWLMALSFIGA
    FEFGHSLMALAGRSSASGSFMTGVLAVFVAAPCTGPFMGAALGASASLPPLSAMAIFIGLGAGLAAPFLLLAVSPRLSAL
    LPKPGPWMERLRQLLAFPLFATVLWLLWVLDELLGQQTWLVASALLLSLAFALWLGQGAGRKMKAFAWILALIVLVIGFR
    QLPTEPSASVQPTASAWRGYDPDLVQQALDEGRPVFIDYTAAW
    CITCQVNKKLVLDTDEIQNLFAERQVLLIRADWTRYD
    QRITQALATLGRNSVPVYAYYPAGSRSPELLPQVLTPALVREHLR

    >gi|192360876|ref|YP_001983718.1| putative glutathione peroxidase [Cellvibrio japonicus Ueda107]
    MLIKAAHCYSGLLFGALLAATGAQAACPDYLQGEYRKLHSQASVDLCELTENKPVLVVNTASHCGFTSQFKEMEAVYQKY
    KDKGLVVVGFASDDFKQEDKDEEKAAEICYLNYGVTFTMLAPTHVTGDQANDLFKTLAKESTEPKWNFNKYLLDKNGKLI
    QHFGSRVKPDAAELTSAIEKVL

    >gi|192362411|ref|YP_001983721.1| putative thiol:disulfide interchange protein DsbE [Cellvibrio japonicus Ueda107]
    MLIRKTILSLGLALVASLMVGAANAQPAPDFTLQSSTGENVRLAEQRGKVVMLNFWASWCGPCRQEMPLLDAMYKRYSAA
    GFVLYGVNVEEDNTDAKKLIKELGVDLPVLYDPESKASSLYKVDAMPTTVLIDKKGQIRYVNRGYKPGDENKYRDQIREL
    IKE

    >gi|192359563|ref|YP_001983927.1| DsbA [Cellvibrio japonicus Ueda107]
    MRILVALLAMVFSLFACAEDKGAEYIEGQHYKLLEIPVRTSDPGKIEVAEVFSYHCGHCFSFEPMLHAWEKKLAPDTYLV
    QTHAMWNAQMEPLIRGYYTSVALKIKDQTHMPVFNAIHLERKNFTSAEDWANFFANYGISKEKTLSTYNSFGVTSMIKQA
    EARARGYKVTGTPEMVVDGKYHISSRLAGGHTEMLKVADFLVAKVRKERGLQAPTP

    >gi|192361825|ref|YP_001984009.1| glutaredoxin 3 [Cellvibrio japonicus Ueda107]
    MARVLMYTTAVCPYCNNAKKLLAEKGVVPEEIRIDTQPQLRQEMMAKSGQRTVPQIWINDFHVGGFTDLWALDKAGKLDA
    LLAQH

    >gi|192359184|ref|YP_001984026.1| dihydrolipoamide dehydrogenase [Cellvibrio japonicus Ueda107]
    MAHIKTQLVVLGSGPGGYSAAFRAADLGLDVTLVERHPTLGGVCLNVGCIPSKALLHVAEVINEAEHADSLGLSFGKVSY
    DLDKVRAYKESVVGKLVSGVGAMAKGRKVRIVEGYGRFVGTHQLEVDNQGEKTTIEFEKAIIAAGSRSVKLSFIPEDPRI
    WDSTSALELRQVPQRLLVIGGGIIGLEMATVYEALGSKVTVVEFADQLVPAADKDLIAVYTKHNKDRFEVLLSTKVEAVA
    AKPEAIEVSFSGAQAPAEPRQFDAVLVAVGRSPNGKLIDADKAGVTVDERGFIPVDEYLQTNQPHIWAIGDIVGQPMLAH
    KATHEGHAAAEGAAGHPHAFHPIAIPSIAYTSPEIAWVGKTEKELKQEGRDYKVAVFPWSASGRAIASDRSEGKTKLIYD
    PVSDRLLGAGLVGIHAGELLGEITLALEFGSSVEDIALTIHAHPTLHESVGLAAELGVGTITDLPNPKATLKK

    >gi|192361139|ref|YP_001984172.1| methylated-DNA-[protein]-cysteine S-methyltransferase [Cellvibrio japonicus Ueda107]
    MSHHYRIMESPVGLLTLVASAKGLVAVLWEDDDKTRVNIDLGSQAENHALLNRVEQQLQEYFAGKRQQFDLPLDFHGTEF
    QQQVWRALLTIPYGETRSYLQIARQIGNEKSVRAVGAANGKNPISIIAP
    CHRVIGSSGKLTGFAGGLEAKALLLRLESPD
    LQADFWHS

    >gi|192360103|ref|YP_001984188.1| putative pyridine nucleotide-disulphide oxidoreductase [Cellvibrio japonicus Ueda107]
    MATYDVIIIGGSYAGMATALQLARGRRQVLVLDTGIRRNRFATHSHGLLGQDGKSPEAIASDAKAQLLNYPNVTWRESAA
    LAVEKTAAGKTGSGFSVTTTDQQTFSAKRLVLASGVRDQLPAIPGLQDRWGKSVFH
    CPYCHGYELNQGQLGVLAVGDVSL
    HQALLIPDWGPTTLFTNHCFTPDDAQQKQLAARGVRIETEAVSEIDGEHNAVVKLVNGRLIKLAGLFVAPLTTPASPIAQ
    ELGCELAESPMGFYVKTDEFKQTTVPGVFACGDLARPAGSVTFAIGDGALAGFAVHKSLIFEGVV