Cellulomonas flavigena DSM 20109 uid48821

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|296128041|ref|YP_003635291.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Cellulomonas flavigena DSM 20109]
    MTSTSAPRLPRVRASELVGRGWLNTGGKDVTLADLRGKVVVLDFWTFCCINCLHVLDELREIEERHRDVLVIVGVHSPKF
    VHEADPVALAAAVERYEVHHPVLDDPDLVTWQAFTARAWPTLVVIDPEGYVVAQMAGEGHAHAVETLVRDLVAEHEAKGT
    LHRGDGPYVAPTPQPTTLRFPAKAVELPGGTFLVADAGHHTLTEVAADGETLVRRIGSGERGLVDGGPDDARFSEPNGLG
    LVPDELRGRVGYDVLVADTVNHALRGVRLSDGHVTTLAGTGEQYMVGAVDNVRPADGDTANPAGSGVGDRWAARQVKLSS
    PWDVAWSTELAAFVVAMAGNHTLWAFDPVGGTVTHLAGTMNEGLVDGTPQEAWFAQPSGLSVDAAGRLWLADAETSALRW
    VDPADASVHSVVGTGLFDFGHRDGAADQALFQHPLGVAALPDGSVLVADTYNGALRRWQPGEGDAPGTVTTLATDLAEPS
    GLVLPSGDTDHVLVVESAAHRLTRVPLPAGAGEQVDGGAHRTQRPVTEIGTDVALEVVFHPAAGQKLDDRWGPSTSLQVS
    ATPPELLLGGGGNDVTLTRTLRLDPTVGEGVLHVTARAASCDADPAIEHPACHLAAQDWGVPVRVATGGDATLVLPLHG

    >gi|296128186|ref|YP_003635436.1| Rhodanese domain protein [Cellulomonas flavigena DSM 20109]
    MDAMQTSITARDFFAAKLTYETDPADLAADRAAGRAPVVVDVRSEAGWRQGRIPGAVHVPGAELSARARDLLPDLDADVV
    VYCWGPG
    CNGSTWGAYALAELGYTRVRELVGGFEYWAREGFAIVTDDGRTRRDPDPLTAPAGR

    >gi|296128201|ref|YP_003635451.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Cellulomonas flavigena DSM 20109]
    MAPTRTRPADNDYRFDVLRTRHVLDDLRYRPTDPGPGDLVPPFDLPTLDGGRFRHDDLGPRPVLLVVGSQTCPVTRSAAP
    RLDALHATYGDRVRFVLVQTREAHPGEHLPQPRTDEEKTAHAVAMRDDLRVTYEVAVDDVDGTLHRALGPKPNSAYVLRP
    DGTIVARVHWANDTAGVRAALDDALDGRPPRHRRGRMLLPLMTAVGHLPDVVHRAGPRAERDVWRAAAPLALLARATRLL
    GALATDRRGPVVAAGLAVVVAATVVAVVIGAAG

    >gi|296128222|ref|YP_003635472.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Cellulomonas flavigena DSM 20109]
    MTSGTATRRLAERQQALQEVQAAQAGQARRRQRISWAAWGAGLLIVATLIAAALITSQPTTSSDVRVAPDFTLPASDGST
    VSLADFRGGPVVLYFNEGAG
    CDSCLLQMAEIEKDPAFAETGITVLPIVMNTAEQINTDRQRLGVQAPFLLDDGTVSAAYD
    TLGKGMHEGLPGHGFVLVDADGNQLWHGNYPSMWLAPADLLKEVTSRL

    >gi|296128230|ref|YP_003635480.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Cellulomonas flavigena DSM 20109]
    MTSSPTATTPGRRIVVVGGVAGGMSAAARARRLDETASIVVLEQSEYVSFANCGLPYHLSGEIESRDALLLHTPQSLRAA
    LALDVRTGSRVTAIDRAARTVTVTHADGTYELPYDALLLAPGAVAVRPPVEGLDHPAVHALRTIPDLDALTARVAALPAD
    GPRRAVVVGAGFIGLEAVEALAARGLEVALVELADHVLPPLDAELAPLLADELRAHGVALHLGVSASAVTSTDDGAALVT
    LSDGTRLPADVVVVNVGVRPASDLARDAGLELGARGAIKVDADQRTSDPYVWAVGDAVEVTQAVTGDTGPVPLAGPANRQ
    GRRAADAMLGRRTTPQAPVLGTAIVRVFGLTAAVTGASQATLARAGVEHETVRIHAGHHAGYFPGAEQVHLVASFAPDGR
    LLGAQAVGREGVDKRIDVLATALRAGMTADDLAELELAYAPPYGAAKDPVNMLGFVAQNVLDGTMPQWTVAEVDAVMASH
    LVLDVRSRAEFAGGHLEGALNVPHTELRDRLDEVRDAADGRPVAVH
    CASGVRAHIATRVVLAAGLDARNLSGGWISLVTT
    RPDLTRTR

    >gi|296128284|ref|YP_003635534.1| Rhodanese domain protein [Cellulomonas flavigena DSM 20109]
    MTRTVTRDELVQLVEDDAAVLIEALPAAHYAREHLPGAINVPGELTPGEASRIAPDPRRTVVVYCSGPGCGRSKVTAAAL
    QRLGYSDVRVYTGGKADWYAAGLPLERSTAAS

    >gi|296128310|ref|YP_003635560.1| glutaredoxin-like protein NrdH [Cellulomonas flavigena DSM 20109]
    MTITVYSKPACVQCTATYRALDKLGHEYTVVDISEDADARDYVMSLGHLQAPVVVVGGEHWSGYRPDRIKALADKLATQV
    A

    >gi|296128318|ref|YP_003635568.1| Rhodanese domain protein [Cellulomonas flavigena DSM 20109]
    MAPALPALVSPELLRTTLEASTASVVVLDATTALAMHGDLEPYTAEPLRDAYLEGHVPGAGFVDVTHELSDTAAEQLFTL
    PAPEALAAAFGAVGVGDDTHVVVYDNVGNAWATRVWWLLRWLGHDAVSVLDGGLGAWRAAGLPVATGGEDDAALRATPRT
    LTPHVRPELLATTSQVAELSAGATPGVLVNALDPETFRGEQSVCPYPRRGRIPGSVNLPLFELLDPETGRLLPVASLRDR
    LQAGGVLGAERAVTY
    CGGGIAATVPAFAAFVVDGTEVAVYDGSLSEWTSDEARPVEVG

    >gi|296128355|ref|YP_003635605.1| UBA/THIF-type NAD/FAD binding protein [Cellulomonas flavigena DSM 20109]
    MTAPTVEAASTGVTPRPPLVPEGPPLDTERLARYARHLTLPGVGVSGQRRLAAARILVIGAGGLGSPALLYLAAAGVGTL
    GVIDDDVVDESNLQRQVIHARADVGRPKVESARDAVLAANPDVAVELHPVRLTAANALEIVRQYDLVVDGSDNFATRYLV
    SDATTLAGIPHVWGALDRFRGQVAVFWSAPPPGHPPVTYRDVFPEAPPPGTVPS
    CAEGGVLGALCATIGSVMVTEAVKLV
    TGAGRSLLGRLALYDAADVTWRELRVLPDPTRPPVTRVEEPAPEVCEVPAPGAAPTTGGEVSATELRDLLDSPTPPFLLD
    VREEFERDIVAIPGAVLVPSGRFQGPGAADAVAALPQDRPVAVY
    CKAGGRSQRVVDALRAAGRHDVLQVTGGVLAWVRDV
    DPSLPRY

    >gi|296128458|ref|YP_003635708.1| peroxiredoxin, OsmC subfamily [Cellulomonas flavigena DSM 20109]
    MPTRTARTAWNGTLQDGGGQVELTSSKVGTYDVSFPKRAAEDAGGTTSPEELIAAAHSSCFAMQLSANVAEAGGTPVALE
    VTADVSLGPDPAGGFRITGIALKVRGEVEGLDAAGFQQAAEAAKAG
    CPVSKALAGTEITLDAALES

    >gi|296128581|ref|YP_003635831.1| Heavy metal transport/detoxification protein [Cellulomonas flavigena DSM 20109]
    MSTTTATTRTVLRAEGFSCPSCVTTIERRLGRLDGVTAVAVRFASARIEVEHDPQRVSVDDLVAAVASVGYAARPA

    >gi|296128793|ref|YP_003636043.1| peptide methionine sulfoxide reductase [Cellulomonas flavigena DSM 20109]
    MASLFETLLGSSLRTTMVDAEHALKGRDGYAYRVPETHVVLGTPLQGPWPEGTRVLYLASGCFWGAEKEAWQLPGVVTTA
    VGYMGGFTPYPTYEETCTGRTGHTETVMVAYDPTVLSDVDLLRHFWEEHDPTQGFRQGNDVGTQYRSAVFFTTPEQEAAA
    RTTRDAYAPVLKARGYGDVTTEIRSVEDAGTFYYAEDYHQQYLRKNPGGYCPVNSTGVACPVPSA

    >gi|296129077|ref|YP_003636327.1| hypothetical protein Cfla_1226 [Cellulomonas flavigena DSM 20109]
    MGDDLPRVTITYCTQCRWLLRAAWYAQELLTTFHRELGEVALRPATGGVFTVHVGDELLWDRAGGRGFPEVTTLKQLVRD
    RVAPGRPLGHSDARATGDVADAPAGPTA

    >gi|296129178|ref|YP_003636428.1| thioredoxin [Cellulomonas flavigena DSM 20109]
    MATTTLTADTIADTIKDNEIVLVDFWASWCGPCRMFGPVFEASSEQHPEIVHAKVDTEAEQELAAELRITSIPTLMAFRD
    GVLVFNQAGALPAPSLEQVVTAVKELDMDEVRAKIAERQATA

    >gi|296129180|ref|YP_003636430.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Cellulomonas flavigena DSM 20109]
    MPRLAVGDTAPDLTLPSTAGGTLSLQDLRGRAVVVYFYPAAATPGCTTQACDFRDSLASLTAAGYEVVGVSPDPLDKLAT
    FVADQALTFPMLSDPDHVALEAWGAWGEKKNYGRTYTGVIRSTVVVDAEGKVALAQYNVKATGHVAKLRRDLGID

    >gi|296129184|ref|YP_003636434.1| pyridine nucleotide-disulfide oxidoreductase dimerization region [Cellulomonas flavigena DSM 20109]
    MADDVSEFDVVVLGAGAVGENAADRASRTGLQVAVVEPELVGGECSYWACMPSKALLRPGDVLAAVRAVAGADGAVTGDL
    DPAAVLAHRDEVAAHWDDAEQVAWVEGAGLTLLRGHARFTGPRALVVEGADGGVRAVRARHAVVVATGSEAVVPEVLAGV
    RAWTSREATSAHRVPPRLAVVGGGVVATEMATAFADLGSDVTVLVRGERLLPAAESFAGEAVARALVARGVRVAFGASVT
    SAVRDGDEVHLDVAHRSGPRDERVERLTVDEVLVATGRRAATADLGLETLGLVPGAPLAVDDRLQVTALDGGWLFAAGDV
    TGRTATTHQGKYDARVVGDVIAARFDPRAAGTADGPDAPRRPSRAAEAAATPWSRYRATADEAAVPQVVFTRPQVAWVGR
    TEAQARDANLDVGVLGYELGDLAAATVTAGGYEGRAQVVVDRARDVLVGATFVGSDVADMLHAATVAVVGEVPLSRLWHA
    VPSYPTLSEVWLRLLEADGR

    >gi|296129219|ref|YP_003636469.1| DSBA oxidoreductase [Cellulomonas flavigena DSM 20109]
    MPVVDFWFDPACPWAWMTSRWMDEAARVRDVDVRWHVMSLSVLNEGRDLPERYRELMDAAWGPVRVLVAAARDHGDGVLK
    PLYDAMGSRVHPGGRTDLDAIVAESLAEVGLPAALADVASTQEVDDLLRASHAQAIELVGDEVGTPVVAIDGVGFFGPVI
    TPAPKGEDAGRLFDGLALVTSVPGFYELKRTRTQGPVFDAPDAA

    >gi|296129406|ref|YP_003636656.1| putative thioredoxin [Cellulomonas flavigena DSM 20109]
    MSAPVHDDVPSGGAVAAPGALLDVRGLTGATPGERATLLQVSTAFCAPCRATHRVLARVAAAVPGVRHLDVDVADAPALA
    AALAVTATPTVVVLDAAGRVVVRAEGVPAPGQVAAALARALPEDGSGSTS

    >gi|296129486|ref|YP_003636736.1| DSBA oxidoreductase [Cellulomonas flavigena DSM 20109]
    MTIDTSTFAAPPRTVTVEVWSDVACPWCFIGKRRFTAALRGFAHRDHVEVVWRSYQLSPEAPVGPGRPEIDALAEMKGLP
    RDQVQQMFAHVTAVAATDGLRYDFERTLAFNTFDAHRLLHLAREAGGAALVDATTEALFSAHFERGVDLGADGALVALAA
    EAGFAAHGWDGARVAAALAGDDAADAVREDLATARELGVTGVPFFVVDRRYAVSGAQPAAVLTQLLEAGWREANPLVVAQ
    TGDVCTDGTC

    >gi|296129756|ref|YP_003637006.1| methylated-DNA/protein-cysteinemethyltransferase [Cellulomonas flavigena DSM 20109]
    MTSTTEQGTTVAGAAPDTATLRALHERLVARAQHDGLLDVAYRVVDSPLGGVLVAAGERGVLRVAFAVQGHDAALADLAT
    RVSPRVLEGGSRLDPVLRELDEYFAGTRRTFDVPLDLRLARGFRRDVLAALPRVGYGATASYGQVAASVGRPAAVRAVGT
    ACALNPVPVLLP
    CHRVVRADGTPGRYAGGDDAKSALIAWERGGSGPLDPHAGRA

    >gi|296129760|ref|YP_003637010.1| Rhodanese domain protein [Cellulomonas flavigena DSM 20109]
    MRLPRPALPLALALALAACTGGTSALSDDTVVVDVRTAAEYAEGHLQGAVNVDVQDAGFADAVAELDPGVPYVVYCRSGN
    RSAAAAATMVAAGLEVTDAGSISDAATSTGLDVVTD

    >gi|296129928|ref|YP_003637178.1| iron-sulfur cluster assembly accessory protein [Cellulomonas flavigena DSM 20109]
    MSETTQTATHGVQLTDVAAGKVRSLLEQEGRDDLRLRVAVQPGGCSGLIYQLYFDERLLDGDATRDYDGVEVVVDRMSVP
    YLDGATIDFADTIEKQGFTIDNPNAGSACACGGSFS

    >gi|296129944|ref|YP_003637194.1| dihydrolipoamide dehydrogenase [Cellulomonas flavigena DSM 20109]
    MADNGTAFDIVVLGGGSGGYAAALRAAELGKTVALVEADKVGGTCLHRGCIPTKALLHAAELADNAREGAHVGVHTHLER
    IDMGGVNQYKDNVIGRLYKGLQGLIKSRKIEVVEGYGKLTGPNTVQVGDRTLTGEHVVLGTGSYARSLPGLDIGGRVMTS
    DQALTLDWVPRSAIVLGGGVIGSEFASVWKSFGADVTIIEALPHLVPNEDEAISKAFERAFRKRGIKFNLGVRFSGVTQD
    DNGVHVSLEDGTTFDADVLLVAVGRGPSTSGLGYEEQGITLDRGFVITDERLHTGVANIYAVGDIVPGLQLAHRGFQQGI
    FVAEQIAGLNPPLIEESGIPRVTYSDPEVGSVGVTEKRAKELYGDDQVEVLEYNLGGNGKSQILSTQGFIKLVRKKDGPV
    VGVHMIGARVGELIGEGQLIVNWEAYPEDVAQLVHAHPTQNEALGEAFLALAGKPLHAHN

    >gi|296129988|ref|YP_003637238.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Cellulomonas flavigena DSM 20109]
    MTPPAPGSPAPDLTLPDTHGTPVTLSGLRGTPVAIVFVPFAFSGTCTGELCELRDNIAAFDEAGVRLLVVSCDPMFALRA
    WAEQEGYTFDLLSDFWPHGAAARAYGVLDETSGHALRGSFLVDADGVVRWSVVNPRGQARPLAAYRQALAALTA

    >gi|296130255|ref|YP_003637505.1| DSBA oxidoreductase [Cellulomonas flavigena DSM 20109]
    MSTDEPVLTDPDRHVLGDPDAPVTVVQYGDLECPYCRDAEPVLRRLVEESDGRVRLVWRHFPLFQLHPHALAAALAVEAA
    GAHGRFWEMQRLLYAHQDALTDDDLARYARELGLDPEEVVGEPADRFARAVQADYEGGIELDVPGTPTLLVDGVPYRGRI
    ELEALRAVVDAV

    >gi|296130257|ref|YP_003637507.1| methylated-DNA/protein-cysteinemethyltransferase [Cellulomonas flavigena DSM 20109]
    MADVESEQPAGTDEPRRAAPRYALVVAPFGPVAVAADDGAVTDVRFPHADGTPATRGLGEPAAPDADPVLAEAVRQLRAY
    LAGELRDFDLPLRLRGSPFQQRVWQGLRAVPYGTTTTYGALAAAVGLDPRTTARAVGAANGANHVPIVVP
    CHRVLGADGT
    LTGFSGGLERKRELLALEARVASGAATLF

    >gi|296130307|ref|YP_003637557.1| glutaredoxin-like protein [Cellulomonas flavigena DSM 20109]
    MTTTPAPGTVTMYSTTWCGYCHRLRKQLDSAGIAYDVVDIEQQPDAAQFVESVNGGNQTVPTVVFPDGSAATNPSLAEVR
    ERLGAVTA

    >gi|296130433|ref|YP_003637683.1| Rhodanese domain protein [Cellulomonas flavigena DSM 20109]
    MSTDERRREVLVEPDELARLLADDEPVTLLDVRWALGRTDGHERYLAAHLPGAVYVDLDTELAAPPSPATGRHPLPAVAD
    LERAARRWGLREGGAVVAYDDAGGTSAARAWWLLRWSGVRDVRLLDGGLPAWTAAGYAVEPGEVTPEQGDVVLVPGALPT
    VDADGAAALASDGVLLDARAAERYAGLVEPVDPRAGHVPGARSAPTQANLGPDGRFLDADALAARFAAVGVRDGVPVGVY
    CGSGVTAAHEVAALASVGVAAALYPGSWSQWSHDPARPVATS

    >gi|296130569|ref|YP_003637819.1| Redoxin domain protein [Cellulomonas flavigena DSM 20109]
    MPDVAHRLARRTAAALAAAALLLLALAGCAADDGRGTAQDVVDQGYQSGDGTRTTWPPDERVGPVEITGTDYEGGTHDLA
    QWRGDVVLLNTWYAA
    CPPCRAEAPDLAAVATDYADEGLRVLGINSRDAAGAAQAFQRQLEVPYPSLDDTSGAAIAALQGV
    VPVNAVPTTVLLDREGRVAARVLGLVEASTLRALVEDLLAEEAA

    >gi|296130658|ref|YP_003637908.1| methionine-R-sulfoxide reductase [Cellulomonas flavigena DSM 20109]
    MTDPRTYPVTKSDAEWALELEPQEFAVLRRAGTERPWTGALLDEHREGVYRCRACGNELFRSDTKFDSHCGWPSFFSPLA
    GDRVELLTDRSLGMVRTEVRCAGCGSHLGHVFDDAPQTPTGDRY
    CMNSVSLTFEPVADDGA

    >gi|296130852|ref|YP_003638102.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Cellulomonas flavigena DSM 20109]
    METTPVDVLVLGGGAAGLAAALTLGRSRRSVRVLDADVPRNATSPHAHNLLTRDGTPPGELLAIGRAEVARYGVEVVTAR
    VTSAPPADDATGEPAFTVGTADGTTHRARRLVLATGMHDVLPDVPGLAERWGRDALH
    CPYCHGWEVRDRALTVLASGPRA
    VHMALLVRQLSADVTLLLHDAFEPSADEWADLAARGVRVLPGRVAGVRVIDDALTGVVLADGDVVPCDAVFVGSRAVLDD
    VVVDGLGLATTPLEHLGERIGRAVTVDPTGATSVTGVWAAGNVTGPQHALAASIAAGSAVGAHVNASLVTSDVARARTR

    >gi|296131204|ref|YP_003638454.1| Methyltransferase type 11 [Cellulomonas flavigena DSM 20109]
    MVEDIREQVRQRYALAALQGTGDAGCCGGDDVGRCGPSDAIVVDERFGAALYDADDAAAVPAEALAASLGCGNPLMVAEL
    REGERVLDLGSGGGIDVLLSARRVGPTGFAYGVDMTDEMLDLARANAARAGATNVEFRKGTIEELPLDDASVDVVISNCV
    VNLSPDKPAVLAEAFRVLAPGGRFGISDVVAEDHLAPEQRAERGSYVG
    CIAGALSRTEYLEGLVAAGFVDAEVEFTHQVA
    DGMHGAIVRARRPQEV

    >gi|296131254|ref|YP_003638504.1| protein of unknown function DUF255 [Cellulomonas flavigena DSM 20109]
    MPNRLAASTSPYLLQHADNPVDWWEWGDDAFAEARRRDVPLLISVGYAACHWCHVMAHESFEDPATAAFMNEHFVCVKVD
    REERPDVDAVYMAATQAMTGSGGWPMTVVATPDGRPFFCGTYFPPRRVQQVPSFPEVLAAVAAAWTGRRAEVLSSADAIA
    DALAARPGPTDGPSGDDRVDERVVARALGALSASFDSRDGGFGGAPKFPPSMVLEWLLRHHARTGDADALGMARRTLDAM
    ARGGVYDQLAGGYARYSVDATWTVPHFEKMLYDNALLLRVHLHAWRMTGDALDRRVVEETADWLLTDLRTAEGGFASALD
    ADSEGREGAFYAWTPAQLREVLGDDDGAWAAHVLGVTDAGTFEHGASVLQLREDPADVARYADVRARLRAAREQRPRPAR
    DDKVVSAWNGLAIAALAEAGALLDRPDWLDAARACARLLADLHTRPGPDGGDRLVRTSRDGVAGRAPGVLEDYADVAEGY
    LALAAVTGEHVWTTWARRLLATVLAHFGDGDGGLYDTADDETDAVLGALRRPQDVADGPAPAGQPAAAAALAHLAALTGD
    LGLREAALGALREPLALSRRYPRATGWALAAAEALLDGPREVAVVGPRDDPATHALHRAALASSAPGLVVALGDPAAADA
    DTPALLQDRPLVDGRPAAYVCRGFVCERPTTDPDELARQLRA

    >gi|296131268|ref|YP_003638518.1| heavy metal translocating P-type ATPase [Cellulomonas flavigena DSM 20109]
    MSAEADRRPPDGTAAAGIDLAIEGMTCASCVARVEKRLNRVPGAHATVNLALETAHVDVVGTDDTPAPTIEALVAAVQAA
    GYDARPLTRPGHGAGTSHDAPGARDHDTTSTDPSHVTPPQDPTAHDAPTHDDVEHALSGMQHAGTEHDPTDDTSAPDDTR
    GADLRRRLRVAAVLTVPVLVLSMLPATQFRGWQWVVAAAALPVVTWAAWPFHRAAYRAARHGASTMDTLVSIGVVAATAW
    SLWALLLGGAGELGMRMTPTLFPAAGAGHGTAMPELYFEVAAVVTTFLLAGRYAEHRSRRRAGDALRALLDLGAKDVALL
    ATGPDGRRVERRVPVDRLAVGDEFAVRPGEKVATDGVVVSGTSAVDTSLLTGEPVPVDVGPGDDVTGATVNTSGHLVVRA
    TRVGEETRLAQIGRLVARAQTGKAPVQRLADRISAVFVPVVLVLAVGTLVAWLVAGGGAQAAFTAAVAVLIIACPCALGL
    ATPTALLVGTGRGAQLGVLIKGPEILEETRRVDTVVLDKTGTVTAGRMALVDVVAAPGEDAAEVHRLAAAVESLAEHPIA
    RAVAGLDRRLTDEEETASPTPQGASRHSSPAASVRDQVDVPVGADGVAIGADEVREFRADAGRGVSGVVRTAHSGVGLAR
    RVLVGRLGWLDEQGVRTQDVADTVAAAEADGATAVVAAWDGRARGVLVLRDPVKPTSADAVRELRELGLRPVLLTGDNRG
    AALATARTVGIAEDDVIAQVLPDEKVAVVERLQTGGARVAMVGDGVNDAAALATADLGLAMGTGTDVAIEAADLTLVRGD
    LASAPQAIRLSRRTLRVIRQNLFWAFAYNVAAIPLAALGLLNPMIAGAAMALSSVLVVTNSLRLRRFA

    >gi|296131403|ref|YP_003638653.1| OsmC family protein [Cellulomonas flavigena DSM 20109]
    MEYTASVRSTAGSHEVAVAAGGQHRSLDLPAREGAAGSDVSGGELLFLALATCATNDVYREAAARSLPVDAVDVEVCGWF
    DAPGARARDVTYRVTVVSSAPEEQVRELVAHVDAIAEVHGTLRSGATVRLDEVRVSRPPEPS

    >gi|296131470|ref|YP_003638720.1| thioredoxin reductase [Cellulomonas flavigena DSM 20109]
    MQREVVIIGSGPAGYTAGIYAARAGLSPLIVAGSVTAGGALVNTTEVENFPGFPDGIQGPELMDKLRAQAEKFGAQVLLD
    DVTALDLTGPVKSVTTGSGEVFTARAVVLATGSAYRELGLADEKRLSGRGVSW
    CATCDGFFFRGQEVVVVGGGDSAVEEA
    TFLTRFASKVTLVHRRDTLRASKIMADRAAANPKIAFAWNSEVVEIHGEDKVTALTLRDTVTGATREHPATGLFVAIGHV
    PRSELLTGQVDLDENGYVRVQGRTTLTNLPGVFACGDVVDHTYRQAITAAGSGAAAALDAQHYLTGLGDVGTAGPVAPGV
    AHQLQEV

    >gi|296131471|ref|YP_003638721.1| thioredoxin [Cellulomonas flavigena DSM 20109]
    MPTTTVTDATFEAEVLRSEVPVIVDFWATWCGPCRQVAPVLEQLSEDYAGRVKIVKLDADANPQTVTAAGVVSIPTLSFY
    VDGAPVKSLIGAKPRQVIAAEIDDLLT

    >gi|296131480|ref|YP_003638730.1| redox-active disulfide protein 2 [Cellulomonas flavigena DSM 20109]
    MNIKVLGPGCRNCVTLERVTREAVEALGIEVEIEKVTDYAAIAGYGVMSTPGLVVDGEVVLYGRVPTAAQVREILEPLVT
    R

    >gi|296131483|ref|YP_003638733.1| mercuric reductase [Cellulomonas flavigena DSM 20109]
    MDENTWDLVVVGTGAAAMAAGIEARSRGKRVLLVEHGPLGGTCLNIGCIPSKNLLAAAGQRHRALANPFPMVPTTAGEVD
    VPALMGRKQDLIDGLRQAKYEDVAAAHGFPIRHGHARFVDEATLHVEDEPVRAAAYVIATGAAPHLPDLPGLHDVAYLTS
    TTAMEQQQLPASMVVIGGGYVGLEQAQLWSHLGVHVTLIGRVAPHTEPEVADVLRAAFLTDGIQLLEEHAVAVERGADDT
    VLVHTASGRTANGERLLVATGRAADTTGLGLDDAGVATDARGFIVVDTHQRTTNPRIYAAGDVTGAPQYVYVAARTGHAA
    AAGALGDPTAVDYRGLPGVVFTTPQLASAGLTEQRALELGHTCDCRVLTAQDIPRALVNQDPRGVLKLVTDAHTRQILGV
    HAALDGAGELMLAATYAIKFGLTIDDIADTWAPYLTMSEALRLAAGLFRTNIPTSCCA

    >gi|296131488|ref|YP_003638738.1| heavy metal translocating P-type ATPase [Cellulomonas flavigena DSM 20109]
    MTEAIELEIGGMTCSSCAARIEKRLNRMPGVEASVNYATEKAKVTLPEGTSLADAVAVVEATGYTARLRPSARSQPAAAS
    DAAAPSRDDETAALRHRLVLSAVLTAPVLALSMVEPLQFDNWQWLSLTLAAPVVAWGAWPFHRAAWANARHAAATMDTLI
    SVGVLAAFGWSLYALFFGAAGRPGMRMAFDIVPDRGGGGHEIYLEVAAAVTVFILLGRYFEARAQKRSGAALRALMELGA
    KDVAVLRDGTEVLIPVQDLSVGDEFLVRPGEKIATDGVVVDGASAVDASMLTGEPVPVEVGPGDPVVGATVNAGGRLLVR
    ATRVGTDTQLAQMARLVEEAQTGKAPVQRLADRISAVFVPIVIALAVATLGFWLGAGAGAEAAFTAAVAVLIIACPCALG
    LATPTALMVGTGRGAQLGILIKGPEVLESTRQVDTVVLDKTGTVTSGQMQLVEVLPAAGHAREEVLRLAGALEDASEHPI
    ARAITAGARHELDVALPAVQQFSNSQGLGVSGIVDGHTVAAGRVSWMADEWAQHLDADLRAGLEVAESAGRTVVAVGWDG
    ALRGLLVVADTVKPTSRQAVAELRALGLRPVLLTGDNARAARAIGAEVGIDDVVAEVMPADKVRVVRELQDAGRVVAMVG
    DGVNDAAALAQSDLGIAMGTGTDVAIEASDLTLVRGDLRAAVDAVRLSRRTLSTIKGNLFWAFAYNVAAIPLAVSGLLNP
    LIAGAAMAFSSVFVVTNSLRLRSFRAVSLDGAARTTGVDRRPVDAVASV

    >gi|296131491|ref|YP_003638741.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Cellulomonas flavigena DSM 20109]
    MTSASATRRLQHDRQLALQEIRQQQAGARRRQVRSWTIWGISLLAILGVVVAALLSARPVESSTERTAPGFTLPVSDGTT
    VSLSDFAGSPVVLYFNEGAG
    CDSCLVQMQKIEQHPGFAEAGITVLPIVMNTAEQINADRLRLGVEAPFLLDDGTVSEAYG
    VLGTGMHEGLPGHGFVLIDPDGTQTWFGDYPSMWLDPADLLKEVTSRL

    >gi|296131534|ref|YP_003638784.1| thioredoxin reductase [Cellulomonas flavigena DSM 20109]
    MTDSAVQPTPSDVRDLVIVGSGPAGYTAAVYAARAGLAPVVVAGSVTAGGALMNTTEVENFPGFPDGIQGPELMDAMQKQ
    AEKFGAQVLWDDATSLDLTGDVKVVTTGGGDVFRARAVILATGSAYRELGLADEKRLSGRGVSW
    CATCDGFFFRDQDILV
    VGGGDSAVEEATFLTRFGRSVTMVHRRDQLRASKIMADRAFADPKISFAWNSQVVAIHGEDKVTGVTLQDTVTGETREVA
    AGGLFVAIGHVPRTDLLLGQVDLDESGYVQVEGRSTRTNLTGVFACGDVVDHTYRQAITAAGSGCAAALDAQHYLAGLTD
    VVDPVTPGSALVLEENVEAR

    >gi|296131535|ref|YP_003638785.1| thioredoxin [Cellulomonas flavigena DSM 20109]
    MSTTDVTDQTFEAEVLRSELPVVVDFWATWCGPCRLVGPVIEELSEEYAGRVKFVKVDTEANPGLYEDFKIQSIPYLAFF
    TGGEMENSLVGARPKAVLKEAVEELLAARA

    >gi|296128220|ref|YP_003635470.1| glutaredoxin 2 [Cellulomonas flavigena DSM 20109]
    MSTIEPADPPVLVTVVHAPACHFCHDAEEALAALAGDFPLVVRSVGIDTDEGRALVAEHRPPMNPLVLVDGEFFSAGRLP
    RKKLTKVLHSRRTAAVGA

    >gi|296131493|ref|YP_003638743.1| glutaredoxin 2 [Cellulomonas flavigena DSM 20109]
    MRPEIVPPVVTVVHAPACHFCLDAEEALGELAVEHRIEVRPVDIDSAEGRTLVALHRPAMSPLVLLDGAFFSSGRLPRKK
    LARALQARTGATTTGAV