Caulobacter segnis ATCC 21756 uid41709

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|295687465|ref|YP_003591158.1| putative disulfide isomerase [Caulobacter segnis ATCC 21756]
    MRRLALAAAMLASLTLAGCNKASAPTAMADDMSLGNKDAKITVVEYASVGCPVCAAWQKEVYPAFKAKYIDTGKVRYVFR
    EMLVGGGSEVTVASAGFLLARCAGKEKYFPVVDAVFASQPGVFDTPRETLLEIAKSSGMSEDQFTQCVTDEAQIKALNAR
    VERNASENDVTATPTFEINGRKMEPGYHSLAEIDAAIDAAGK

    >gi|295687561|ref|YP_003591254.1| Thioredoxin domain-containing protein [Caulobacter segnis ATCC 21756]
    MSLIGEKPAAPASGKSEHIKDGSDATFMADVIEASKTQPIIVDFWATWCGPCRQLTPTIEKVVNAAKGAVKLVKIDVDAN
    PAFAGQLRVQSIPTVYAFVDGRPVDAFQGALPESQVKAFVEKLAKAGGGESPLDELIALGKESLEIGDVGGAAQAFAQAL
    QTDPTNVKAIGGMARAYLIGGDLEGAAEVVAMAPADAKDPDLDAARAALALAEEAPSETAAVEKRLAADPDDHEARFELA
    KALAGAGHLQAAADHLLTIIARDRAWNEEAARKQLLTVFEAAGPTSEVAKQGRRKLSSILFS

    >gi|295687597|ref|YP_003591290.1| thioredoxin [Caulobacter segnis ATCC 21756]
    MSTVVVTDATFESDVLKASKPVLVDFWAEWCGPCKQIAPALEQISEELADVVTVAKVNIEDSPTTPSRYGVRGIPTMMLF
    RDGQMTSMKVGAMPKQKILEWLNEAGVQPA

    >gi|295687740|ref|YP_003591433.1| Redoxin domain-containing protein [Caulobacter segnis ATCC 21756]
    MAIKVGDTLPAATFMTSTAEGPAPISTDDIFKGKTVALFAVPGAFTPTCSAKHLPGFKDHAADLKAKGVDTIACVSVNDV
    FVMKAWGKDQGIDGEVLLLADGNGDFTRAIGLDFDGSKFGMGARSQRYSLIAKDSVVTQLNVEEAGQFKVSSAEYLLEQL


    >gi|295687793|ref|YP_003591486.1| thiol:disulfide interchange protein DsbA [Caulobacter segnis ATCC 21756]
    MTLDRRALIAAGLAASGSAWAAPAVARAAPLPPVPGEMVLGSPTAPVQLVAYASASCPHCAHWWTEVLPQVRKSFVDTGK
    VRFVFREFLTPPTEFAAAGFILARRIPGKYFEVLSTVFQRQEEIYRSEKLWEGLQAIGKQYGLTDAQFAAAMNDPAALKG
    VNDRFFRALNQENIEVTPTFFVNGAPIEGDTGFDALAKAFAVAAKG

    >gi|295687794|ref|YP_003591487.1| DSBA oxidoreductase [Caulobacter segnis ATCC 21756]
    MRSLISRVTLVAALAAGLASCGPKSETVTADDMTQGNPNAKVTVVEYASASCSHCAQWNEEVYPAFKAKYIDTGKVNYVY
    REILTPPNEVAAAAFLMARCAGKDKYFQVVDSVYRAQHQMFQTGQFREGLLTVAQSAGMSEEQFNACVTDEKGLKALNDR
    VQKYSKEAKIQGTPTFVVNGKKVGPEEGGARTLAELDAAIAEASK

    >gi|295688009|ref|YP_003591702.1| alkyl hydroperoxide reductase subunit F [Caulobacter segnis ATCC 21756]
    MLDAGLKTQLTTYLQNLRQPIELVASLDDSSGSAEMKALLEDIVATSDKVSLNLAGDNERKPSFAITRAAGDADVRFAGL
    PLGHEFTSLVLALLHVGGHPPRLDAEVIERIKGLDGDYRFETYFSQS
    CQNCPDVVQALNTMSALNPRIRHVAIDGAFFKA
    EVEERQVMAVPTILLNGQPFGQGRMDVEQILAKLDTGAADRMAEKIKAKDAFEVLVIGGGPAGAAAAIYAARKGIRTGVA
    AERFGGQVLDTMDIENFISVSHTEGPKLASALEQHVKDYEVDVMNLQKAVGLVPAKTPGGLIEIKLENGASLKSKSVILS
    TGARWRNVNVPGEAEYKNKGVAY
    CPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVAHVTLIEFDSQLRADAVLQRKLA
    SLPNVKIVTSAMTTEIHGDGARVNGLSYKDRNGDAVHRVDLEGVFVQIGLVPNTEWLKDSGVALTPRGEIEVDYRGETSI
    PGVFAAGDATTAPYKQIIIAMGEGAKASLSAFDYLIRLPAEASQVAA

    >gi|295688010|ref|YP_003591703.1| peroxiredoxin [Caulobacter segnis ATCC 21756]
    MSLINTEIKPFTAQAFKDGKFVTVSDTDVKGKWSIFFFYPADFTFVCPTELEDLADNYDTFQKLGVEIYSVSTDTHFSHK
    AWHDSSPAIGKIKYTMIGDPSGLVTNNFDIMRPGIGLADRGTFLVDPQGVIQFLEVTAEGIGRNAAELLRKVKAAQYVAS
    HPGEVCPAKWEEGEKTLAPSLDLVGKI

    >gi|295688111|ref|YP_003591804.1| Ohr subfamily peroxiredoxin [Caulobacter segnis ATCC 21756]
    MTDAIYTAHAHAVGGRNGTAKSDDGHLDVKLAFPKSMGGDGNGTNPEQLFAAGYSACFLGALGLVARNQGVKLGEHSLDA
    EVDLIKDETSFHVGVRLKLNAPELDRETAEKLLHAAHEV
    CPYSKATRGNVQVDLEVA

    >gi|295688315|ref|YP_003592008.1| glutaredoxin 3 [Caulobacter segnis ATCC 21756]
    MAKVTIYTRPFCGYCARALALLSEKGADFTEIEAGMDPALRQEMMQRSGRSTFPQIFVGDQHIGGCDDMMALEEQGKLDP
    LLAA

    >gi|295688350|ref|YP_003592043.1| thioredoxin reductase [Caulobacter segnis ATCC 21756]
    MSTTAPRQTRCLIIGSGPAGYTAAIYAARALLKPVLIAGIQPGGQLTITTDVENYPGFADVIQGPWLMDQMRAQAEHVGT
    ELVNDIVTSVDLSKRPFTVKTDSGQDWIAETIIIATGAQAKWLGLESESKFQGFGVSA
    CATCDGFFYRNKEVVVVGGGNT
    AVEEALFLTSFASKVTLVHRKDELRAEKILQERLLAHPKIEVVWDSVIDEVKGDTDPMGVTGVRLKNIKTGATTDLACDG
    VFIAIGHAPSSELFAGQLETGPGGYLKVKPGTASTAIKGVYAAGDVTDDVYRQAVTAAGMGCMAALEAVRFLAEEDHKKA
    HHPISHAEANKIGVW

    >gi|295688356|ref|YP_003592049.1| rhodanese domain-containing protein [Caulobacter segnis ATCC 21756]
    MTTAQLIPLKPEDAAQRVADGRAVLIDIREPDEFARRRARGALSRPVSTLAAKGLGAPDAREVIFTCRSGMRTGAHAGAL
    AAACGTRGYVLDGGLDAWDAAGLPVEVDAKAPLEMMRQVQIAAGLLVLTGVVLGLLVSPLFFGIAGFVGAGLTFAGVTGF
    CGMARLLALAPWNRPASA

    >gi|295688626|ref|YP_003592319.1| glutaredoxin-like protein [Caulobacter segnis ATCC 21756]
    MTDAATSPALDFIAKTVAENPVVVFMKGVPDQPRCGFSSVVVQILDHLGVAFVGVDVLQDDDLRQGVKTFTDWPTIPQLY
    VKGEFVGGSDIVREMFQSGELKTFLAEQGVLAA

    >gi|295688834|ref|YP_003592527.1| iron-sulfur cluster assembly accessory protein [Caulobacter segnis ATCC 21756]
    MTQTDLTLSENAARRIKAIAASEGRTLMLRVAVDGGGCSGFQYRFDLVDSVEDDDLKIERDGAAALVDVVSLALLKGSEI
    DFVDELAGAEFRVRNPNAKSSCGCGVSFSI

    >gi|295689287|ref|YP_003592980.1| heavy metal translocating P-type ATPase [Caulobacter segnis ATCC 21756]
    MSQSLTLHRDLEAFVRRDEAGKGRLELLVSGARCAGCINKIEKAVREIPGVDAARLNLTTGKLAVQLEGKEADPERVVET
    VEALGYRACLFDPGEAAAAQDREGRELAVALGVAGFGAGNVMMFTVPAWAGLFGQELNSSTLTLMYWMAAIVATPCALFA
    GRPFFRSAWASLKRGKANMDVPISIGVILTLIVSFSETILRGKHAYFDAAVTLLFLLLIGRYLDHRLRANARSAARDLLA
    LQTPVAMRLIDGVEQGVPVADVKIGDQLVVAPGDRVPVDGLVESGQSELDNALITGETALAPVGAGARLHAGALNLSGRL
    VMTATARSEDSTVAAIARLMEAGAQTRSAYVRLADKAAALYVPVVHTAAALTFVGGWALGLGPREALLRAAAVLIVTCPC
    ALGLAVPAVQIAASSRLFRKGVLVKSGAALERLAEVDHVVFDKTGVLTEGRPRLIDAPAHLVAMAAPLARASRHPLAKAM
    AAQAGLGPVAIDCVETAGQGVEGVIDGRRARLGRAAFVGVTGGDARETELWFGFENDIKIRFVFEDQPRADAADTLARLR
    RMGLSVEILSGDLAGPVSDIAREVGVAEWRAGLTPFDKAAIVDQFKADGRKVLMVGDGLNDAAALSKAHASMAPGAAVDA
    AQNAADLVFTGEGLEAVVEAIDTAREARRRALENFGFSALYNVVATPAAMFGLINPFIAALAMSGSSMVVLLNAARPRIA
    WRRR

    >gi|295689301|ref|YP_003592994.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Caulobacter segnis ATCC 21756]
    MSAPRRFDAIIIGAGQAGPSLAGRLTAAGQTVAMIERKDFGGTCVNTGCMPTKTLVASAYAAHLARRADDYGVVLDGPVG
    IDMKRVKARQQTVVKNARGGVEGWLRGMKGCTVFQGHARFESADTISVGDDLLTAPKIFLNVGGRANVPDMPGVNDIPYL
    TNVGMMQLDTLPEHLVIVGGSYIGLEFAQMFRRFGSRVTIVEMGPRLIGREDPEISDAIREILEAEGITVRLNAECIRFS
    PHEDGACVHVTCKAGEPQVTGSHVLLAVGRRPNTDDLNLEAAGVETDKRGYVVVDDQLRTNVPGIWAMGDCNGKGAFTHT
    AYNDFEIVAANLLDDDPRKVSDRISCYGLFVDPPLGRVGMTEAEARATGRPLLVGKRPMTRVGRAVEKGETAGFMTVVVD
    AKTKQILGAAILGLNGDEAIHGMIDLMYAKAPYTTIQRAVHIHPTVSELIPTMLGELKPV

    >gi|295689304|ref|YP_003592997.1| rhodanese domain-containing protein [Caulobacter segnis ATCC 21756]
    MSIPSDPLVSTAWLAEHLDAPDVRVVDASWHMPAAQREPYKEFLAAHIPGAVFFDIDDISDETSDLPHMIPTAVKFASRV
    KKLGLGDGSRIVVYDSIGILPAARAWWHFRAMGHEDVVVLDGGLPKWIAEGRPIEDGPAAPQERHFTPRYQADIYRSLEQ
    MRDVVASGREQIIDARAAGRFEGRDPEPREGLRGGHMPGARNIPLAAMIAPDGTMLPADKLRTVFEAAGVDINKPIVST
    C
    GSGITASVVALALARMGKPRSAVYDGSWTEWGGLADTPVATGPAA

    >gi|295689368|ref|YP_003593061.1| peroxiredoxin [Caulobacter segnis ATCC 21756]
    MSVYDYSAKTLDGQDASLAEYRGQVLLIVNTASKCGFTPQYEGLEQLWRTYKDRGFTILAFPCNQFGAQEPGDASEIANF
    CSLTYDVTFPVMSKIDVNGGDAHPLYKFLKKEQKGLLGTEAIKWNFTKFLIGRDGEVVERFAPTTKPEDLTAAIEALL

    >gi|295689369|ref|YP_003593062.1| dihydrolipoamide dehydrogenase [Caulobacter segnis ATCC 21756]
    MSTEFDVVVIGAGPGGYVAAIRASQLGLKTAIVERENLGGICLNWGCIPTKALLKSGEIYEQLSHLGGYGLSVEKASFDF
    TKIIERSRGVAKQMSSGIAFLMKKHKIEVIEGEAKLEKGNPAPKLVIALKAGGSRTVQAKNVILASGARAREIPAIGAVS
    DGDKIWTYRDALAPKSMPKSLVVIGSGAIGIEFASFYRALGAEVTVVEAIDRIMPVEDEEVSKAAQKAFEKRGIKFRIGA
    KVGKIEKTKDGVAVTVEASGKIEQLTAEKCIVAVGIAPNNEGLEALGVSLDRGHVVTDKHGRTNVPGLYAIGDIAGGPWL
    AHKASHEGIHAAEAIASYKTPNVHSPIPGCTYANPQVASVGYTEAGAKAAGIEVKAGRFPFRVNGKAVAAGEVEGFVKTV
    FDAKTGALIGAHMIGHEVTEMIQGFVTAITLEATEEDLHGIVYAHPTMSEAMHEAALDAYGRVLHI

    >gi|295689413|ref|YP_003593106.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Caulobacter segnis ATCC 21756]
    MSKSLKERLADLHAERERTWDPAALKINVDQRRTLVETADPTRWVQVGQRLAPFVLKDVEGGDLSLERLLERGPAVLVFF
    RFAG
    CPACNIALPYYEERLAPALRDLGATLVAVSPQVPERLVDIKVRHGLSFKVASDLGNDLSRQFGVLYTADEASQAAQ
    RAKGAFIGETTGTGTWELPQPAVVVIDHERVVRFVDVSPDWLVRTEAEPVLEAVRDITLVPAE

    >gi|295689428|ref|YP_003593121.1| rhodanese domain-containing protein [Caulobacter segnis ATCC 21756]
    MTLPLITPHEVRRDLIARREIALLDLREEDPFAKAHPLFASQLPLSRLEIEILDRVPRKATKIVLYDDAEGLVAPAAERL
    AALGYTNVHTLHGGLAGWRAAGYELFQDVNSYSKAFGELVEARRHTPSLPAQEVKARIDAKADQVILDARRFEEYATMSI
    PGGINTPGAELVLRARELAPDPSTTIIVN
    CAGRTRSLIGAQSLVNAGLPNPIFALRNGTIGWTLAQQTLEHGQSRKFPSV
    GEQTLEEARARAHDVAYRAGVRRVDAQGLADLAKDIDRTLYRFDVRTPDEYVAGHIPGFRSAPGGQLVQETDVFAPVRGG
    RIVLADDLGPRADMTASWLAQLGWEVYVLEGGFGGALERGLWTSSLPALPEVETISPRDLAQAIADDAVVVIDLAPSPVH
    RKGHVPGAWFAIRAQLDVAVTQVPPNTTIVLTSPDGALATLAAPELEALTDRPVRVLAGGTEAWIAAGRAVETGLVRPAN
    APTDIYKRPYEGTDNAAEAMQAYLDWEFGLVDQLARDGTHGFYVI

    >gi|295689480|ref|YP_003593173.1| OsmC subfamily peroxiredoxin [Caulobacter segnis ATCC 21756]
    MKITRTGSAAWSGGIKDGKGSISTESGALQAYPYGFSSRFEGQPGSNPEELVGAAHAACFTMALSLALGEAGLRADQMDT
    SAKVTLEQVDGGYAITASHLTLRARIPGADQATFEKLAAGAKAG
    CPVSKLLNAEITLDAALVE

    >gi|295689521|ref|YP_003593214.1| DSBA oxidoreductase [Caulobacter segnis ATCC 21756]
    MAQSQPMIIDVVADVVCPWCYLGWRRLKSALALRPNLEAQVIWRPYQLDPSLPEEGVDHKAYMAQKFKDPDRLKAVHAAL
    VEGGAEEGITFDFEAIDLSPNTNAAHRLIRWALTAGVQDPVVEALFKAYFEQGLDIGDPVVLADIAEAAGMERLVVLQLL
    SEGADKEAVAREHAMAVQGGVTGVPFAIFAGKVAVVGAETPERIAEAIDQALAA

    >gi|295689535|ref|YP_003593228.1| iron-sulfur cluster assembly accessory protein [Caulobacter segnis ATCC 21756]
    METAITARPRRPRPKVVTLTDAAAARVKAIMDKADKPYVGLRVGVKNGGCAGQEYVFEYAETKGPIDEVVEDKGVTILIE
    PKAVLFLIGTEIDYEVSKLSSKFVFHNPNETDACGCGESVTIQPAAEVHE

    >gi|295689548|ref|YP_003593241.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Caulobacter segnis ATCC 21756]
    MLQPGDKAPDFDLPTDTGRVSLSALKGKNVVLYFYPKDDTAGCTSEALQFSSEVEEFQKLGAVIIGVSKDSAASHAKFRA
    KHDLTIELAADPMGDIVEAYGAWVEKSMYGRKYMGIDRSTFLIDREGVVREVWRKVKVPGHIKAVMNAAKAIK

    >gi|295689558|ref|YP_003593251.1| DSBA oxidoreductase [Caulobacter segnis ATCC 21756]
    MTLLRRAATLALPLAVSGLVLAGCDQAKPDKAFGEKVRAYLLEHPEVLMEVSQKLQEKQANQQAVSAQKAIGQYRQAIER
    DPRDVVINPAGTITVTEFFDYR
    CGYCRHAAPEIVELVQKNPDIRLVLKDFVIFGRDSEAAARLMLGAKDQGKSLDLYKAL
    MAENALDAAGALRIAKGLGIDLDKAKAAGESEAVTQHLADTEALAKTLALQGTPAFVVGDTLIPGADINALKLAIEQTRA
    SKVKAG

    >gi|295689692|ref|YP_003593385.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Caulobacter segnis ATCC 21756]
    MKTVLAGVAAAALAFASPALAALKVGDKAPDFSAKAALAGKDFDFSLAKALKKGPVVLYFFPAAYTAGCTAEAHEFAEAT
    PEFEKLGATVIGVTAGNVDRIKDFSKEHCRDKFAVAAADKALVKNYDVALAVKPDWSNRTSYVIAPDGKILLSYTDGNFM
    GHVTQTMGAVKAYNAKK

    >gi|295689719|ref|YP_003593412.1| arsenate reductase and related protein [Caulobacter segnis ATCC 21756]
    MTLTMYGIKNCDTVAKARKWLEDRGLAYGFHDYKAAGIDRPRLEAWVEELGWEPLLNRAGTTFRKLDEADKQNIDREKAI
    GLMLANPSMIKRPVLDLGDRRLVGFKPDLYEAALG

    >gi|295689778|ref|YP_003593471.1| arsenate reductase [Caulobacter segnis ATCC 21756]
    MCAPDFPVVIYHNPSCGTSRNVLAMIRAAGYEPTVIEYLQTGWTHDQLRDLASAAGLTFRQLMRTRGAPAEELGLTADDV
    SEAEILDAMVAHPILVNRPLVVTQRGVKLCRPSEVVFDLLDRLPSSFTKEDGEVVDLSGPP

    >gi|295689839|ref|YP_003593532.1| arsenate reductase [Caulobacter segnis ATCC 21756]
    MSDSDFPVVIYHNPNCGTSRNVLAMIRAAGYEPKVIEYLRTGWTHDQLQDLAKEAGLSFHQLMRTRGTPAEELGLTAEGV
    SEAKILEAMIAHPILVNRPLVVTPRGVKLCRPSEVVFDLLDRHPDSFTKEDGEVVDLSARP

    >gi|295690207|ref|YP_003593900.1| methionine-R-sulfoxide reductase [Caulobacter segnis ATCC 21756]
    MTDAAILSTAGFDLTPPTEPERERLEADLTAEEARVLLHHGTEAPFCGGLLGEKNPGAYCCRLCGLPLFKHETKFESGTG
    WPSFYAPFAEDHVVGVRDTSYGMVRIETRCARCDSHQGHVFPDGPAPTRLRY
    CINSVSLQFVKSGDPLPDPLHRGDQVA

    >gi|295690234|ref|YP_003593927.1| Redoxin domain-containing protein [Caulobacter segnis ATCC 21756]
    MSEVQSGQNEPGAAKRSPLRLALAGVILVGVAAVLYVIVTASFKPHGPANLTEFKKGTLEKLDVPETPRPAPATVFTSLD
    GKPATLADFKGRVVVMNLWATW
    CAPCKAEMPTLAKLQAAYATQPVTVLPISVDRDSDLNLVKAEMAANPPLVTYRDPSYK
    LSFDLQPRAAGYPTTVIYDRQGRERARLAGPADWSAPEVRGLVEKLLAEK

    >gi|295690320|ref|YP_003594013.1| glutathione-disulfide reductase [Caulobacter segnis ATCC 21756]
    MADYDYDLFVIGAGSGGVRAARLAAMSGAKVGVAEEYRVGGTCVIRGCVPKKFMVYASEVTSHLKTAKGYGWTIGEAKFD
    WKGFIHDKDVEIARLSGIYVTNLQKAGADLLHGRAQVVDAHTVEVLPKDGSKDAGTYTARKILIATGGRPVKPDFPGAEF
    GITSDEAFHLPKLPKSIMIVGGGYIAVEFAGIFAGLGVETTLLYRGANILRGFDDDVRAHLADELGKRGIKVVLGCSHTR
    IEKQEDGTLLSVLNNDLTFETEAVMFATGREPYVHGLGLEKAGVKLNERGAIAVDAYSKTNVDSIWAVGDVTDRINLTPV
    AIREGAAFAQTEFYNNPTTFDHDMVASAVFSQPPVGAVGMSEAEARHAFGAVDIYRSVFRPMKITFYGGQERCLIKLVVK
    ADDQKVVGVHIVGPDSPEIIQMAAIAVKMGVTKQQWDSTCAVHPTLAEELVTMREKYVPVEVGGVG

    >gi|295690544|ref|YP_003594237.1| arsenate reductase [Caulobacter segnis ATCC 21756]
    MTTTDFPITIFHNPACGTSRNVVAMVRAAGYEPEIVEYLKAGWTRDQLKDLAAKSGLSVRQLLREKGTPAEALGLLADGV
    AEDRILDAMIEQPILVNRPIVVSPKGANLCRPSELVLDLLDQRPASFTKEDGEVVKL

    >gi|295690598|ref|YP_003594291.1| peptide methionine sulfoxide reductase [Caulobacter segnis ATCC 21756]
    MRRLLALLAAAFALLITGAPALAAPKTETAVFAGGCFWCMEHDMGGIPGVLKVESGYTGGHVKNPTYRDVTSERSGHYEA
    VRVTYDPAKLDYGFLLYRYWKLVDPTDDGGQFCDRGPSYRPALFVTPAQRPIAEKSRAEAAKRLKTGTMKAQILPLQTFY
    PAEEYHRDYAKRNAANYNAYRVGCGRDARLKQVWGG

    >gi|295690664|ref|YP_003594357.1| peptide methionine sulfoxide reductase [Caulobacter segnis ATCC 21756]
    MLSLKKTLEMPTVDTALPGRAEPIPTAETHFVNGHALKGPYPDGLETAIFAMGCFWGVERIFWKIPGVYVTAAGYAGGIT
    PNPTYEETCTGRTGHTEVVLVVFDPKVVTYEALLKTFWENHDPTQGMRQGGDIGTQYRSGIYVTNDAQAAAAVESKEAYQ
    QALSAKGLGDITTEIAAAGPFYFAEDYHQQYLAKNPNGYCGIGGTGVVCPIGLGVPGGVPGGVEA

    >gi|295690728|ref|YP_003594421.1| Ohr subfamily peroxiredoxin [Caulobacter segnis ATCC 21756]
    MTTLYTTRATVVGGREGHARSEDGLLDVQLSMPKSLGGKETGTNPEQLFAAGYAACFQSAMGHVARTQKIPLTGSTVTGQ
    VSLASAGAGFALEVALEVETQGLSQADAEALVATAHQV
    CPYSNATRGNVDVAISVKAA

    >gi|295690829|ref|YP_003594522.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Caulobacter segnis ATCC 21756]
    MTPLASDRPAYDTPYDAIVVGAGPAGLTAATYLGRFHRKTLVLDGGMSRASWIPESHNTPGFPHGVGGEALLARLREQAD
    RYGAQRRPGRARSLVRGADGFVLAFETEAPGEDADAPVIARAPFVLLATGVVDRLPAMEGVEDAIRAARVRL
    CPICDAYE
    ATGQRIAVLGDSEHGAREAAFLTTYSADVTLLDLRPDAARQGDGVFARMPVALADITVGPNAVTIAAAGQAERTFDCLYL
    ALGFDSQQTLARQAGAVLDADGRLTVNAHQQTSVEGLYAAGDVVRGLNQIAVATAEAAIAATDIHNQLRALTA

    >gi|295690844|ref|YP_003594537.1| OsmC family protein [Caulobacter segnis ATCC 21756]
    MTEDLRTRPFATATDSGHGGLQTFVTAGPSTIVADIAVAQGGLDLGPDPHELVAAGLAACTSMTLRLYANRKGWTISHMH
    VEVFSHFDKDQTPHERFERVITIEGDLNDEQLERLFEIADR
    CPIHQLLTNGARVVTTVGGN

    >gi|295691037|ref|YP_003594730.1| methylated-DNA/protein-cysteine methyltransferase [Caulobacter segnis ATCC 21756]
    MTHPVRLFLDRAPSPIGEILIVTDETGLLRAVDFHDFEPRLRRLLGLHYGALPLEDGAAPAETKAAFARYFAGDISALTD
    LPWDTGGTPFQRAVWRALAAIPPGETVTYSELARRVERPAAIRAVGAANGANPLSLVAP
    CHRVIGMSGALTGYAGGVERK
    RWLLAHEGVVQAKPMPLAT

    >gi|295691055|ref|YP_003594748.1| methylated-DNA/protein-cysteine methyltransferase [Caulobacter segnis ATCC 21756]
    MPTQGFALFDTSIGRCGLAWGASGLIGLQLPESTPGAAWARLRRRFPEAVESEPPPEVEAVIDRIRDLLSGGRDDLADVP
    LDLGGQSAFNLRVYEIARAIAPGETSTYGEVAKAMGEPGAARAVGKALGENPWPIVVP
    CHRVLSASGGIGGFSAPGGSTT
    KARLLTLEKAKTDAVPTLFDLEFSVAPPRGARVPSPLAGEGVAESDG

    >gi|295691147|ref|YP_003594840.1| dihydrolipoamide dehydrogenase [Caulobacter segnis ATCC 21756]
    MAQYDVVIIGGGPGGYNAAIRAGQLGLKTAIVEGRGKLGGTCLNVGCMPSKALLHASEMYASATGPEFAKLGIEVKPKLN
    LPQMMAQKAESVEALTKGVEFLMKKNKVDYVKGWGRIDGAGKVVVKAEDGSEATLETKNIVIATGSEPTPLPGVTIDNKR
    VVDSTGALSLPEVPKHLVVVGAGVIGLELGSVWKRLGAEVTVVEYLDRILPGTDTEVANAFQKILTKQGFKFQLGAKVTG
    ATASAKGVKLGFEPVAGGDAQTIEADYVLVAIGRRPYTQGLGLETVGITPDKRGMIANDHFKTGVAGVWVIGDVTSGPML
    AHKAEDEGVACIEMIAGKAGHVNYGIIPGVVYTSPEVATVGQTEDDLKAAGVAYKVGKFPFLANSRAKINHETDGFVKIL
    ADAKTDRILGAHAVGPNVGDMIAEVCVAMEFGGASEDIARTCHPHPTRSEAIRQAAMGVEGWTMQA

    >gi|295691276|ref|YP_003594969.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Caulobacter segnis ATCC 21756]
    MPITRRLVAATLPLAALLPGAANAKPAPDFTAIDVDGKTRSLSEFRGKTVVLEWTNEGCPYVRKHYSGNMQGLQQAARAD
    GVVWLTVASSAPGKQGHFPDGAAAKSWMSAKGAKPTALLLDPEGKVATAYKAKTTPHMFVIDKAGQVVYEGAIDDRPTSK
    VEDIAGAQNLVAAALADVKAGRKVATPFAPPYGCSVKYKDA

    >gi|295691278|ref|YP_003594971.1| cytochrome c biogenesis protein transmembrane region [Caulobacter segnis ATCC 21756]
    MFLKRAVLALQAFVAATLLTGAAIAGPIVNSGHIESELVPQETGIAPGGTIYVALRQKIQQDWHTYWRNPGDAGEPTKIA
    WTLPSGWSAGDMVWPTPIKAKLGPLLDYAYEGEVLIPVPISAPASAQVGTTVSLTAKVSYLVCEQVCVPEDAELSLLLPV
    VAGSPSADPQWGGKIAEVLAKAPKPAGLKAVFKLDGQALKLAVTGGPLKGADMADAYFFPYSPKVIEHAAEQTIERGPEG
    LTLTLKPGYDFVGGGTPPASLEGVLALADGSAWEIGATAGEPPATASGLGAPPVKSQPSAAGAPGGLAGALVLAFLGGLI
    LNLMPCVFPVLSMKAASLAGHAHHESKARAQGLAFLAGVLATFLALAGLLLAVRAGGAAVGWGFQLQSPLVIAALALLML
    LVALNMSGVFEIGTSIQGVGAGASSRDGALGAFFTGALAVIVAAPCTAPFMAGALGYALTQPAVVALGVFAALGLGFAAP
    FVAVAFIPAVLQRMPRPGAWMETLKKGLAFPMYGAALWLTWVFAQQAGPIALGQVLGAGVLAAFGAWLYGLAQGRRATGK
    AFLVQMIVGLLCVTVALALAVSAALAAKPPTVAAAAPSSGPGLVAEAWSPERVAALRAEGRPVLVDFTAAW
    CVTCQVNEK
    VALSGGKVAEAFKVRNAVLLKADWTNRDPVIAKALADFGRVGVPLYVVYPKNGGEPVILPQLLTEGMVIEAIEKAGA

    >gi|295691520|ref|YP_003595213.1| periplasmic protein thiol/disulfide oxidoreductase DsbE [Caulobacter segnis ATCC 21756]
    MKRWLAFVPLLVLLALAGLFAGYALKRDPRVQPHALVGKPAPALSLPELTTGTATAIRMPGQGPILVNFFASWCAPCEVE
    HPQLMALKAQGVKVVGVAYKDAPANTQAFLTRLGDPFALKLVDRDGRAGLEFGVTGVPETYLVGSDGVIIAKHTGPLTPD
    AAEDLLKKAK

    >gi|295691590|ref|YP_003595283.1| AraC family transcriptional regulator [Caulobacter segnis ATCC 21756]
    MAARTGRTALSDATSVSDMAYDASFLSTGLPEAASQELARLAERSVDYHRMAKALDWLAERWSDHPSLDEAAQAVGLSPF
    HFQRIFTRWAGVSPKTFVSAIAHAEARRSLEAGGTVLDAAFDAGLSGPSRLHDLFIAQEAATPGEVRRRGAGMRLRWGWA
    PTPFGKGLFVMAERGLAGLAFSDGDDEMSFADMHRRFPAADWTRDDAAAQGMALRAFIRGGGAGGEGPLPVVLIGSPFHI
    QVWKALLTIPTGATATYGQVAAWAGKPGAFQATGGAIGANPISLLIP
    CHRAIAKSGKLTGYHWGLARKAAILGMEAVAAA
    G

    >gi|295691594|ref|YP_003595287.1| UbA/THIF-type NAD/FAD binding protein [Caulobacter segnis ATCC 21756]
    MGFSQDEVERYARHLVLREVGGPGQQKLKAARVLMVGAGGLGAPAALYLAAAGVGTIGLVDPDTVSLSNLQRQVLYAASD
    VGRPKVEAAKEHLTALNPHVTVATHPVWLDPQNANDLVQQYDLVLDGTDDFATRFAVSDACLAHGKPLVSGALGRWTGQV
    GVFHGQPCYRCLVPEVPPDAET
    CALVGVVGALAGVIGSMMALEAVKLIAGAGEPLSGKLLIYDALAAETRTVRIGADPAC
    PACGAN