Caulobacter crescentus NA1000 uid59307

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|221233048|ref|YP_002515484.1| thioredoxin [Caulobacter crescentus NA1000]
    MSLIGEKPAPSSKSDHIKDGTDASFMADVIEASKTQPVIVDFWATWCGPCRQLTPTIEKVVTAAKGAVKLVKIDVDKNPG
    FAGQLRVQSIPTVYAFVDGRPVDAFQGALPESQVRAFVEKLAGAAEGGALDEIIAMGKESLEIGDLGGAAQAFAQALQID
    PTSAKALGGMARVYLANGDPEGAAEVVAMAPADAKDPDLDAARAALALAAEAPSETAAFEQRLAADPDDHEARLELAKAL
    AGVGRLQDAADHLLTIIARDRTWNDDAARKQLLTVFEAAGPTSEVAKQGRRKLSSILFS

    >gi|221233156|ref|YP_002515592.1| thiol:disulfide interchange protein DsbD [Caulobacter crescentus NA1000]
    MFLKKAVLALQALVMGAMLGGHALAGPVVNSGHVESELVAQEAGIAPGGTIYVALRQKIAPGWHTYWRNPGDAGEPTKIT
    WTLPEGWSAGDMVWPTPVKTRLGPLLDYAYKGEVLIPVPITAAANAQPGTTLSLTADVFYLVCEQVCIPEQAKLSLLLPV
    VAGTPAPDPKWGAVIGKVLADAPKPAGLKAVFKLEGQALKLAVTGGPLKGADMAGAYFFPYSSKVIEHAAEQAIERGAEG
    LTLTLKPGYDFVGGSTPPAELVGVLATKAGAWEVTATAGEALAGASGLGPPPAEAAPGGALAGGLAGALLFAFLGGLILN
    LMPCVFPVLSMKAASLAGHAHEAPKARLQGLAFLLGVVATFLALAGALLAVRAGGAAVGWGFQLQSPLVIAGLALLMLLV
    ALNMSGIFEIGTSVQGVGAGASAKGGVSGAFFTGALAVVVAAPCTAPFMAGALGYALTQPPVIALGVFLALALGFAAPFV
    AVTFIPGALKLLPRPGDWMEVLKKGLAFPMYGAALWLVWVFAQQAGPIALGQLLVAGVLAAFGAWLYGLAQARRAVGKGS
    AVSMILGLLAVVGALALAAASALSAKPPVAAAEASTPSGPGLTAEAWSPEKVQALQAEGRPILVDFTAAW
    CVTCQVNEKV
    ALSGPKVAEAFKAQNAVLLKADWTNRDPVIAKALADFGRVGVPLYLVYPKNGGEPVILPQLLTEGMVIEAIERAGS

    >gi|221233159|ref|YP_002515595.1| thiol-disulfide isomerase and thioredoxin [Caulobacter crescentus NA1000]
    MSITRRLVAAALPLAAFVPAVAHARPAPDFTAIDADGKTRSLSEFRGKTVVLEWTNEGCPYVRKHYSGNMQGLQQAARAD
    GVVWLTIASSAPGKQGHFADGAAAKAWMNARGAKPTALLLDADNKVATLYKAKTTPHMFVIDKTGAVVYEGAIDDKPTNK
    VEDIQGSKNLVAAALGDLKAGRKVATPFVTPYGCSVKYKDA

    >gi|221233188|ref|YP_002515624.1| SCO1/SenC family protein [Caulobacter crescentus NA1000]
    MPRHRLVLILACVVGLAVAVGLAWNVGVFRSEPAVTVGGPFELVDQNGAPTSEKALKGKWSAVFFGFTYCPDVCPGTLQG
    LAAATDQLGPKAKDFQIVFISIDPARDTVKQMKAYLSAPYVPKATIGLTGTQAQVDAAAKAYRVYHAKVGDGVDYTMDHS
    TAIYLMDPKGRFKTVIPYNLPPDEIARRIKDAVREG

    >gi|221233285|ref|YP_002515721.1| dihydrolipoamide dehydrogenase [Caulobacter crescentus NA1000]
    MARPEGDRPMAQYDVVIIGGGPGGYNAAIRAGQLGLKVAIVEGRGKLGGTCLNVGCMPSKALLHASELYAAATGPEFAKL
    GIEVKPKLNLSQMMAQKAESVEALTKGVEFLMKKNKVEYVKGWGRIDGVGKVVVKAEDGSETTLETKNIVIATGSEPTPL
    PGVSVDNKRIIDSTGALSLPEVPKRLVVVGAGVIGLELGSVWKRLGAEVTVVEYLDRILPGTDTEVANAFQKILVKQGFK
    FQLGAKVTGAEAGAKGVKLSFEPVAGGEAQTIEADYVLVAIGRRPYTQGLGLETVGVTPDKRGMIANDHFKTGVAGVWVI
    GDVTSGPMLAHKAEDEGVACIEMIAGKAGHVNYGIIPGVVYTSPEVATVGKTEDELKAEGVAYKVGKFPFLANSRAKINH
    ETDGFVKILADAKTDRILGAHMIGPNVGDMIAEYCVAMEFGGASEDVARTCHPHPTRSEALRQAAMGVEGWTMQA

    >gi|221233317|ref|YP_002515753.1| thiol:disulfide interchange protein DsbA [Caulobacter crescentus NA1000]
    MTLDRRILIASGLALTAGPSVARARSLPPAPGDMVLGAATAPVQFVVYASPSCGHCAHWWTTELPAIRKTFIDTGKVRLV
    FREFLTPPNEFAAAGFLLARRVPGKYFEVLTTVFQKRETIFESGRLWEGLQAIAQQYGLTEAQFTTAMNDTKALDGVNTR
    FRRAIGEDQVEVTPTFFVNGAPYEGEADLAALSKIFALAAKG

    >gi|221233318|ref|YP_002515754.1| thiol:disulfide interchange protein DsbA [Caulobacter crescentus NA1000]
    MRSLLSRVTIVAALAASLAACSPKSAEVTAEDMVLGDPNAKVTVIEYASVACPHCATWNAEVFPAFKAKYIDTGKVKYVH
    RDALTGEPRLANAGAMLARCAGKDKYFQVTEALYRAQTNIFTSGDIRGELLTIAQAAGMNEAQFNSCLSDENAAKSAERI
    EKMMTDNNIRGTPTFEVNGKRLGGEEGGEQTLAQLDAAIAEASK

    >gi|221233633|ref|YP_002516069.1| O6-methylguanine-DNA methyltransferase [Caulobacter crescentus NA1000]
    MTTQGFALFDTAIGRCGLAWSQSGLIGVQLPEATPGAAWARLRKRFPDAVEADPPPEVEAAIDRIRDLLAGDRDDLADIV
    LDQDGQSAFNLRVYAIARAIPPGETSTYGQVARALGEPGAARAVGKALGENPWPIVVP
    CHRVLGSSGTLGGFSGSGGGET
    KARLLTIEKARTSAAPTLFDLEFSVAPPRGG

    >gi|221233662|ref|YP_002516098.1| O6-methylguanine-DNA methyltransferase [Caulobacter crescentus NA1000]
    MRGRCGGPFFVKGGPVFPPLIRPSGPPSPARGEGRNYRADSRARLGDHRPMPRPAHLFLDRAPSPLGDLLIVTDETGLLR
    AVDFHDFEPRLRRLARLHYGDLVLETGPAPAAIKAAFARYFAGDLAALVSLAWATNGTPFQQAVWTALTQIPAGQTITYS
    ELARRAGRPLAIRAAGAANGANPLSLVAP
    CHRVIGTDGALTGYAGGIDRKRWLLAHEGAL

    >gi|221233683|ref|YP_002516119.1| ADA regulatory protein/O6-methylguanine-DNA [Caulobacter crescentus NA1000]
    MTAPTYPDDDARWNALRAKDRAAQGAFYIGVRTTGIYCVASCGGRPLRKNVDFHATREAARAAGLRACLRCKPDLDRETL
    RWGVVQTSLGLALIARSDAGLRLVALGDDVESLRGDLETRFKQARLIPDTAGLAADLAAVATLVDHPEQRPDLPLDALGT
    DLQKAVWAALRRIPAGRTVSYADIAHAIGQPKAFRAVAQACGANPLAVITP
    CHRVVRSDGGLSGYRWGVARKRALLAREA
    A

    >gi|221233809|ref|YP_002516245.1| glutaredoxin [Caulobacter crescentus NA1000]
    MAKVTIYTRPFCPYCSRAVALLTDKGADFTEIEAGMDPALRQEMMQRSGRNTFPQIFVGEQHIGGCDDMMALEDQGKLDS
    LLSA

    >gi|221233900|ref|YP_002516336.1| organic hydroperoxide resistance protein [Caulobacter crescentus NA1000]
    MTTLYTTRATVVGGREGHARTEDGLLDVQLSMPKSLGGKETGTNPEQLFAAGYAACFQSAMGHVARTQKIALAGSTVTGQ
    VSLATAEVGFRLEVALEVETQGLSQADAEALVAAAHAV
    CPYSNATRGNIDVAITTKAA

    >gi|221233983|ref|YP_002516419.1| methionine sulfoxide reductase A [Caulobacter crescentus NA1000]
    MLSLHKTLEMPSADTALPGRAAPIPTAQTHFVNGHALKGPYPEGLETAIVAMGCFWGVERVFWKVPGVYVTAAGYAAGIT
    PNPTYEEVCTGRTGHTEVVLVVFDPKVVTYEALLKTFWENHDPTQGMRQGNDIGTQYRSGLYVTSDAQAAAAAESKAAYQ
    QALSARGLGTITTEIAPAGPFYFAEDYHQQYLAKNPNGYCGIGGTGVVCPIGLGVEG

    >gi|221234028|ref|YP_002516464.1| peptide methionine sulfoxide reductase [Caulobacter crescentus NA1000]
    MRRLIVLFAAALAVLGATAPALAAPKTETAVFAGGCFWCMEHDMQGVPGVLKVESGYTGGHLKNPTYRDVTSETSGHYEA
    VRVTYDPAKLDYGFLLYRYWRLVDPTDDGGQFCDRGPSYRPAVFVTPAQRPIAEKSRTEAAKRLKTGTMKTQILPAQTFY
    LAEEYHRDYAKRNKLNYFAYRTGCGRDARLKQVWGG

    >gi|221234410|ref|YP_002516846.1| E1-E2 cation pump ATPase FixI [Caulobacter crescentus NA1000]
    MSHSLALHRDLEAFVRRDDAGRGRFELLVRGARCAGCISKIEKAVRALPGVEAARLNLTTGKLSVELAGKISDPGRVLET
    VEDLGYRACLFDPAEAEAAQDKEGKELALALGVAGFGAGNVMMFTVPAWAGLFGQELTPATLTLMYWMAAIVATPCALFA
    GRPFFRSAWASLRRGKANMDVPISIGVILTLIVSFSETLLGGKHAYFDAAVTLLFLLLIGRYLDHRLRAGARSAARDLLA
    LQAPVARRLTDGVEQGVPVADIRVGDLLAVAPGERIPVDGLVEQGASELDNALITGETALAPVAAGARLHAGALNLSGRL
    VMRASARSEDSTLAAIARLMEAGAQARSTYVRLADKAAALYVPVVHTAAALTFVGGWALGLGPREALLRAAAVLIVTCPC
    ALGLAVPAVQIAASSRLFRRGVLVKSGAALERLAEADHVVFDKTGVLTQGRPALIDAPAHLVAQAAPLARASRHPLARAL
    AAEAGAGPVAQDCVETAGQGVEGVIDGRRARLGRAAFVGVQAGDVRETELWFGFENNVKIRFAFEDRPRADARDTITKLR
    ALGLSVEILSGDVEGPVRDVAREVGVSDWRAGLTPVEKAAAIDALKAQGRKVLMVGDGLNDAAALSKAHASMAPGAAVDA
    AQNAADLVFTGDELAAVVESIETAREARRRALENFGFSALYNLVATPAAMFGLVNPFVAALAMSGSSIVVLLNAARPRLR
    SFNR

    >gi|221234429|ref|YP_002516865.1| 3-mercaptopyruvate sulfurtransferase [Caulobacter crescentus NA1000]
    MSTPSDPLVTTAWLAQHLEAPDVRVVDASWHMPAAQRDPHKEFLAAHIPGAVFFDIDEIADESTDLPHMIPSPTKFASRV
    RKLGLGDGSRIVVYDSTGILPAARVWWHFRAMGHEDVVVLDGGLPKWISEGRPIEDGPAFPQERHFTPRYQADVYRSLDQ
    MRDIVATGREQIVDARAAGRFEGVDPEPRAGLRGGHMPGARNIPLSALIAPDGTMLSAEKLKSVFEAAGVDINKPVVST
    C
    GSGITASVVALALARMGKPRSAVYDGSWTEWGGLADTPVVTGPAQ

    >gi|221234508|ref|YP_002516944.1| arsenate reductase [Caulobacter crescentus NA1000]
    MTDIAFPITIFHNPACGTSRNTVAMVQAAGYAPQVVEYLKTGWTREQLQDLAAKSGGSLRALMREKGTPAETLGLLADEV
    SDERLLDAMVEHPILVNRPIVVTPKGVKLCRPSEQVLDLLDRKPEQFTKEDGEVVTP

    >gi|221234651|ref|YP_002517087.1| arsenate reductase [Caulobacter crescentus NA1000]
    MAGRGQASIRPGTDLVMTPTLYGIKNCDTVAKARKWLDDHGRSYAFHDYKATGIDRPRLEAWVAEVGWEVVLNRAGTTFR
    KLPDADRQDLDAAKAVDLMLAQPSMIKRPILDLGDRRVVGFKPDWYAAAFG

    >gi|221234682|ref|YP_002517118.1| thioredoxin peroxidase [Caulobacter crescentus NA1000]
    MKIVLAGVAAVALAFASPALAALKAGDKAPDFSAKGALAGKDFDFNLAKALKKGPVVLYFFPAAYTAGCTAEAREFAEAT
    PEFEKLGATVIGMTAGNVDRLKDFSKEHCRDKFAVAAADKALIKAYDVALAVKPDWSNRTSYVIAPDGKILLSHTDGNFM
    GHVQQTMGAVKAYKAKK

    >gi|221234741|ref|YP_002517177.1| glutathione peroxidase [Caulobacter crescentus NA1000]
    MAMSIYDYSAKTLDGQDVSLADYRGQVLLIVNTASKCGFTPQYEGLEALYKAHKDRGFTVLAFPCNQFGAQEPGNAEEIA
    NFCSLTYDVSFPVMSKIDVNGADAHPLYKFLKKEQKGVLGTEAIKWNFTKFLIGKDGQVVDRFAPTVKPEDLKVAVEALL


    >gi|221234742|ref|YP_002517178.1| dihydrolipoamide dehydrogenase [Caulobacter crescentus NA1000]
    MSTEFDVVVIGAGPGGYVAAIRASQLGLNTAIIERENLGGICLNWGCIPTKALLKSGEVYEQLSHLGGYGLSVEKASFDF
    GKIIERSRGVAKNMSGGIAFLMKKHKIEVIEGEAKLEKGAPAPKVVVALKAGGSRTVQAKNVILASGARAREIPAIGAVS
    DGDKIWTYRDALAPKSMPKSLVVIGSGAIGIEFASFYRALGAEVTVVEAIDRIMPVEDEEVSKAAQKAFEKRGIKFRVGA
    KVSKIEKTKDGVAVTVEAGGKIEQLTAEKCIVAVGIAPNNDGLEALGVSLDRGHVVTDKHCRTNVPGLYAIGDIAGAPWL
    AHKASHEGIHAAEAIAGYKTPNVLSPIPGCTYANPQVASVGYTEAGAKAAGIEVKAGRFPFRVNGKAVASGETEGFVKTV
    FDAKTGALIGAHMIGHEVTEMIQGFVTAITLEATEEDLHGVVYAHPTMSEAMHEAALDAYGRVLHI

    >gi|221234856|ref|YP_002517292.1| FrnE protein [Caulobacter crescentus NA1000]
    MSQPQAMIIDVVADVVCPWCYLGWRRLKSAIALRPDLKAQLIWRPYQLDPTLPEDGVDRKAYMAQKFKDPEKLKAVHTAL
    VEGGAEEGIVFNFEAIALSPNTNAAHRLIRWALTAGVQDHVVEALFKAYFEQGLDIGDPIVLGDIAEAAGMERLVVLQLL
    SEGADKEAVAREHAMAVQGGVTGVPFAIFAGKVAVVGAESPERIAQAIDQALAA

    >gi|221234871|ref|YP_002517307.1| HesB protein family [Caulobacter crescentus NA1000]
    MEPMEPTIAVRPRRPRPKVVTLTDAAAARVKEIMDKADQPYAGLRVGVKNGGCAGQEYVFEYAKEKGPIDEVVEDKGVTI
    LIEPKAVLFLVGTEIDYEVTKLSSKFVFHNPNETDACGCGESVTIQPAAEALD

    >gi|221234884|ref|YP_002517320.1| thioredoxin peroxidase [Caulobacter crescentus NA1000]
    MLQPGDKAPDFDLPTDTGRVSLSALKGKNVVLYFYPKDDTAGCTSEALQFSSEVEEFQKLGAVIIGVSKDSAASHAKFRA
    KHDLTIELAADTLGDVVESYGAWVEKSMYGRKYMGIDRSTFLIDREGVIREIWRKVKVPGHIKAVMNAAKAIK

    >gi|221234893|ref|YP_002517329.1| outer membrane protein [Caulobacter crescentus NA1000]
    MTMLRRAATFAVPLAIAGLTLAGCDQSKPDKAFGEKVRAYLLEHPEVLMEASQKLQEKQAAQQAVSSQKAIGEYRQAIER
    DPRDIVINPAGTITVTEFFDYR
    CGYCRQATPAVLELVQKNPDIRLVLKDFVIFGNDSEAAARIALGAKDQGKSLELHKAL
    MAENALDARGALRIAERLGIDMDKAKAVGESQAITQHLADTDALARALNLSGTPAFIVGDTLVPGADIDALKLAIEQTRA
    ARAKAG

    >gi|221235025|ref|YP_002517461.1| HesB protein family [Caulobacter crescentus NA1000]
    MTQIDLTLSENAARRIKAIGEAEGRALMLRVAVDGGGCSGFQYRFDLVDSVEDDDLKVERDGAAALVDVVSLALLKGSEI
    DFVDELAGAEFRIRNPNAKSSCGCGVSFSI

    >gi|221235202|ref|YP_002517638.1| methionine sulfoxide reductase B [Caulobacter crescentus NA1000]
    MTDAATLSTAGFDLTPPTEAERERLEANLTAEEARVLLHHGTEAPFCGGLLGEKSPGVYGCRLCGLPLFKHETKFESGTG
    WPSFYAPFAEDHVVGVRDTSYGMVRIETRCARCDSHQGHVFPDGPAPTRLRY
    CINSVSLQFVKAGAPLPDPLHRGDKIT

    >gi|221235230|ref|YP_002517666.1| thiol:disulfide interchange protein TlpA [Caulobacter crescentus NA1000]
    MNEVQSGQNGEEAKKRNPMRMALAGVILLGVAAVLYVIASASFKPSGPADLTEFKKGAFEKLDVPATPRPAPTTVFTSMD
    GKPTTLADFKGRVVVMNLWATW
    CAPCKAEMPTLAKLQAAYATQPVTVLPISVDRDSDLNLVREEMAANPPLVTYRDPSYK
    LSFDLQPRAQGYPTTIIYDRQGRERARLAGPADWSAPEVRGIVEKLLAEK

    >gi|221235323|ref|YP_002517760.1| glutathione reductase [Caulobacter crescentus NA1000]
    MADYDFDLFVIGAGSGGVRAARLAALSGAKVAVAEEYRVGGTCVVRGCVPKKFMVYASEVTSQLKTAKGYGWTIEDARFD
    WKTFLHEKDVEIARLSGIYVTNLQKAGAHLLHGRAQIVDAHTVEVLPKDGSDDAGTYTARKILVATGGRPVRPVFPGAEL
    GITSDEAFHLPTLPKSVLVVGGGYIAVEFAGIYAGLGVQTTLLYRGANILRGFDDDVRMHLADELEKRGIKVVLGCSHKS
    IEKLDDGRLLSTLSNDLTFETEAVMFATGREPYVQGLGLEKAGVKLNDKGAIAVDKYSKTNVDSIWAVGDVTDRINLTPV
    AIREGAAFAQTEFYGNPTTFDHDLVASAVFSQPPVGAVGMSEAEARQAFGKVDIYRSIFRPMKVTFYGGQERCLIKLVVK
    QDDERILGVHVVGPDSPEIIQMAAIAVKMGVTKPQWDSTCAVHPTLAEELVTMREKYVPAEVGGAG

    >gi|221235527|ref|YP_002517964.1| glutaredoxin [Caulobacter crescentus NA1000]
    MTDAATSPALDFIAKTVADHPVVVFMKGVPDQPRCGFSSVVVQILDHLGVEFVGVDVLQDEDLRQGVKTFTDWPTIPQLY
    VKGEFIGGSDIVREMFQSGELKTFLTEQGVIAA

    >gi|221235748|ref|YP_002518185.1| glutaredoxin [Caulobacter crescentus NA1000]
    MGKSALVAALRHDQKVRTDMRRPATTAHLHRMVMPGHTCPYGLKALDLLKRKGFKVEDHLLTTRADTDAFKAREGVLTTP
    QVFIDVSAVSANETD

    >gi|221235892|ref|YP_002518329.1| rhodanese-like sulfurtransferase [Caulobacter crescentus NA1000]
    MTPQTTTPLTPDDAAQRLADGRAVLVDIREPDEFARRRARGALSRPLSTLESQGLGLPDAREVIFTCRTGMRTGANGQRL
    AQVCGGRAYVVEGGLDAWDAAGLPVDHNAKAPLEMMRQVQIGAGVLVLIGVVLGLLVSPLFFGLAGFVGAGLTFAGVTGF
    CGMARLLALAPWNRPAVA

    >gi|221235900|ref|YP_002518337.1| thioredoxin reductase [Caulobacter crescentus NA1000]
    MSPLRRIHTISPPMSTLSPRQTRCLIIGSGPAGYTAAIYAARALLKPVLIAGIQPGGQLTITTDVENYPGFADVIQGPWL
    MDQMRAQAEHVGTEFVSDIVTSVDLSKRPFTVKTDSGQDWIAETIIIATGAQAKWLGLESEAKFQGFGVSA
    CATCDGFFY
    RNKDVIVVGGGNTAVEEALFLTSFASKVTLVHRKDELRAEKILQERLLAHPKIEVIWDSVIDEVLGQTDPMGVTGARLKN
    VKTGETQEVAADGVFIAIGHAPSSELFAGQLETGSGGYLKVKPGTASTAIEGVYAAGDVTDDVYRQAVTAAGMGCMAALE
    AVRFLAEEDHKAAHHPISHAEANKIGVW

    >gi|221235948|ref|YP_002518385.1| peroxiredoxin [Caulobacter crescentus NA1000]
    MSLINTEIKPFTAQAYKDGKFVTVSEADVKGKWSVFFFYPADFTFVCPTELEDLADNYDVFTRLGVEIYAVSTDTHFSHK
    AWHDSSPAIGKIKYTMVGDPSGQVTNNFEIMRPGVGLADRGTFLVDPQGVIQFMEVTAEGIGRNAIELLRKIKAAQYVAA
    HPGEVCPAKWEEGEKTLAPSLDLVGKI

    >gi|221235949|ref|YP_002518386.1| peroxiredoxin reductase (NAD(P)H) /NADH oxidase H2O2-forming [Caulobacter crescentus NA1000]
    MLDAGLKAQLTTYLQNLRQPITLVASLDDSKGSVDMRALLDDVASTSDKVSVRFDGDDARKPSFAIERAANDAEVRFAGL
    PLGHEFTSLVLALLHVGGHPPRIDAEVIERIKALDGDYQFETYFSQS
    CQNCPDVVQALNTMSALNPRIRHVAIDGALFKA
    EVEARQVMAVPTILLNGQAFGQGRMEIEQILAKLDTGAADRMAEKIRAKDAFEVLVVGGGPAGAAAAIYAARKGIRTGVA
    AERFGGQVLDTMDIENFISVPHTEGPKLASALEQHVKDYEVDVMNLQKAVGLVPAKTPGGLHEIKLENGANLKARTLILS
    TGARWRNVNVPGEAEYKNKGVAY
    CPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVAHVTLIEFDSQLRADAVLQRKLA
    SLPNVTIIKSAMTTEIHGDGSKVNGLTYKDRTSDTAHRVDLEGVFVQIGLVPNTEWLKDSGVALSPRGEIEVDYRGETSI
    PGVFAAGDATVTPYKQIIIAMGEGAKASLSAFDYLIRLPASEAAEAA

    >gi|221236029|ref|YP_002518466.1| OsmC-like protein [Caulobacter crescentus NA1000]
    MNGAGRSASFSAPFKDPPMTDTPTRPFATATDSGHGGLQTFVTAGPATIVADLSAAQGGLDLGPDPHELVAAGLAACTTM
    TLRLYANQKGWDISGLHVEVFSSFDKETTPHERFERIITLEGDLTDEQRERLFQIAEK
    CPIHKLLTAGAKVVTTVAGN

    >gi|221236413|ref|YP_002518850.1| rhodanese-like sulfurtransferase [Caulobacter crescentus NA1000]
    MEARMSFVSAIPAAAPEVAAAHFAARLSLETDCADVAAAMRAGEVDFVLLHVVGAPQAYARRHVPGALHLRHAEISAERM
    SAWPADTLFVVYCAGPH
    CNGADQAALKLARLGRPVKLMIGGITGWADEGLPFAEGAEPGSL

    >gi|221236441|ref|YP_002518878.1| peroxiredoxin [Caulobacter crescentus NA1000]
    MAIKVGDTLPAATFMTSTAEGPAPISTDDIFKGKTVALFAVPGAFTPTCSAKHLPGFKEKADELKAKGVDSIVCVSVNDV
    FVMKAWGKDQGIDGEVLLIADGNGDFTKAIGLDFDGSKFGMGARSQRYSLVAKDGVVTQLHVEDAGQFKVSSAEYLLEQL


    >gi|221236589|ref|YP_002519026.1| thioredoxin [Caulobacter crescentus NA1000]
    MRPPRRTPPRDARLEQTMSTVAVTDATFEADVLKSSKPVLVDFWAEWCGPCKQIAPALEQLSEELADVVTIAKVNIEDSP
    TTPSRYGVRGIPTMMLFRDGQMTSMKVGAMPKQKILEWLNEAGVQAA

    >gi|221236724|ref|YP_002519161.1| thiol:disulfide interchange protein TlpA [Caulobacter crescentus NA1000]
    MKRWLAFSPLIVLVALAVLFAGYALQRDPRVQPQALVGKPMPALMLPDLDTGRPAPLRQTGEGPILVNFFASWCAPCEVE
    HPQLMALKAQGVTVVGIAYKDAPANTQAFLTRLGDPFAAKRVDRDGRAGLEFGVTGVPETYLVGSDGVIIAKHTGPLTPD
    AAEDLLKQAK

    >gi|221236748|ref|YP_002519185.1| peroxiredoxin reductase AhpD (NAD(P)H) [Caulobacter crescentus NA1000]
    MSIEALRARLPDYAHDLGTNLALLVDDPALDPEARWGCFVASACAVGEPQTLRAIDAAATAAGLTAEANRAARKAAAMMA
    MTNVYFRAVHLMEGAAYQALPCRLRLNRLAHAGARGVTYDLSCVAVSAINGCGA
    CLDSHEADLRGRGVEPTQIQAALRIA
    AVVSAVARTLAAEAALHPQNLEI

    >gi|221236778|ref|YP_002519215.1| molybdopterin biosynthesis MoeB protein [Caulobacter crescentus NA1000]
    MWRGRGGGSSAMSFSDGEVERYARHLVLREVGGPGQQKLKAARVLVVGAGGLGAPAALYLAAAGVGTIGLVDPDIVSLSN
    LQRQVLYATGDVGRPKVEAASEHLRTLNPNTSVETHPVWLDASNAQAVVSGYDLVLDGTDDFATRFAVSDACVVQGKALV
    SGALGRWTGQVGVFHGQPCYRCLVPDIPPDAET
    CALVGVVGALAGVIGSMMALEAVKLITGAGEPLSGRLLIYDGLAGET
    RTVRIGRDPQCPSCGA

    >gi|221236781|ref|YP_002519218.1| ADA regulatory protein/O6-methylguanine-DNA methyltransferase [Caulobacter crescentus NA1000]
    MTMAYDASSLSDAISEAARQELARLAERSVDYHRMAKALDWLAERWSDHPPLDDAAQAVGLSPFHFQRIFTRWAGVSPKT
    FVSAIAHAEARRSLEAGGTVLDAAFDAGLSGPSRLHDLFIAQEAATPGEVRRRGAGMRLRWGWAPTPFGRGLFVMADRGL
    AGLAFSDGDDEASFADMHRRFPAADWSRDDLAAQATALHAFAGGEGPLPVVLIGSPFHVQVWKALLRIPTGETATYGQVA
    AWAGKPKAFHATGGAIGANPISLLIP
    CHRAIAKDGRLTGYHWGLARKAAMLGMEAVAAAS

    >gi|221236716|ref|YP_002519153.1| hypothetical protein CCNA_03780 [Caulobacter crescentus NA1000]
    MRSMRKAALSLFSLVLSGVVATLSWGGVAWAQKPPVVVELFTAQGCSSCGKANQVAADLAKQDGVLALTYAVDYWDYLGW
    KDTFAKPVFAERQRAYAKKFALRDVPTPQMVVAGRVQASGTKAEAVEDLVKTAARARLNPPDMQFIGAARVAVGSGPAPR
    GGGEVWLVRYDPREQDIAIKRGDNKGQTLVHRNVVRELVRLGPWAGKPKLYRLPAANDADLVTVVLVQGAKGGRILGVLQ
    SAGEAKR

    >gi|221233750|ref|YP_002516186.1| dimethylaniline monooxygenase [Caulobacter crescentus NA1000]
    MTGKLPKACVIGAGCSGFTTIKRLKDYGIPYDCFEMSDEVGGNWYYKNPNGLSACYESLHIDTSKWRLAFEDFPVPKDWP
    DFPHHAQLFQYFKDYVDHFGLRPTITFNTKVESAKRTADGLWAVTLSGGETQFYDVLFVCNGHHWDPRVPEYPGEFDGPA
    FHAHAY
    CDPFDPVDMRGKNVVVVGMGNSAMDIASELSQRPIAKNLWVSARRGVWVFPKYLNGKPADKTALPAWMPRKLGV
    ALSRSVLKKTIGRMEDYGLPKPDHEPLEAHPSVSGEFLTRAGCGDIKFKPAIKALEGKRVRFTDDSVEDVDAIVFATGYK
    ISFPFFDDPALLPDADHRLPLFKRMMKPEVPNLFYMGLAQPLPTLVNFAEQQAKLAAAYLAGQYALPPPAEMARITAKDE
    HRHTGHFYDSARHTIQVDFNVYCADLKKEIAKGEARARNAGGKLPVAARAEGQALAAE