Caulobacter crescentus CB15 uid57891

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|16124365|ref|NP_418929.1| thioredoxin [Caulobacter crescentus CB15]
    MSLIGEKPAPSSKSDHIKDGTDASFMADVIEASKTQPVIVDFWATWCGPCRQLTPTIEKVVTAAKGAVKLVKIDVDKNPG
    FAGQLRVQSIPTVYAFVDGRPVDAFQGALPESQVRAFVEKLAGAAEGGALDEIIAMGKESLEIGDLGGAAQAFAQALQID
    PTSAKALGGMARVYLANGDPEGAAEVVAMAPADAKDPDLDAARAALALAAEAPSETAAFEQRLAADPDDHEARLELAKAL
    AGVGRLQDAADHLLTIIARDRTWNDDAARKQLLTVFEAAGPTSEVAKQGRRKLSSILFS

    >gi|16124472|ref|NP_419036.1| thio:disulfide interchange protein [Caulobacter crescentus CB15]
    MLGGHALAGPVVNSGHVESELVAQEAGIAPGGTIYVALRQKIAPGWHTYWRNPGDAGEPTKITWTLPEGWSAGDMVWPTP
    VKTRLGPLLDYAYKGEVLIPVPITAAANAQPGTTLSLTADVFYLVCEQVCIPEQAKLSLLLPVVAGTPAPDPKWGAVIGK
    VLADAPKPAGLKAVFKLEGQALKLAVTGGPLKGADMAGAYFFPYSSKVIEHAAEQAIERGAEGLTLTLKPGYDFVGGSTP
    PAELVGVLATKAGAWEVTATAGEALAGASGLGPPPAEAAPGGALAGGLAGALLFAFLGGLILNLMPCVFPVLSMKAASLA
    GHAHEAPKARLQGLAFLLGVVATFLALAGALLAVRAGGAAVGWGFQLQSPLVIAGLALLMLLVALNMSGIFEIGTSVQGV
    GAGASAKGGVSGAFFTGALAVVVAAPCTAPFMAGALGYALTQPPVIALGVFLALALGFAAPFVAVTFIPGALKLLPRPGD
    WMEVLKKGLAFPMYGAALWLVWVFAQQAGPIALGQLLVAGVLAAFGAWLYGLAQARRAVGKGSAVSMILGLLAVVGALAL
    AAASALSAKPPVAAAEASTPSGPGLTAEAWSPEKVQALQAEGRPILVDFTAAW
    CVTCQVNEKVALSGPKVAEAFKAQNAV
    LLKADWTNRDPVIAKALADFGRVGVPLYLVYPKNGGEPVILPQLLTEGMVIEAIERAGS

    >gi|16124475|ref|NP_419039.1| hypothetical protein CC_0220 [Caulobacter crescentus CB15]
    MSITRRLVAAALPLAAFVPAVAHARPAPDFTAIDADGKTRSLSEFRGKTVVLEWTNEGCPYVRKHYSGNMQGLQQAARAD
    GVVWLTIASSAPGKQGHFADGAAAKAWMNARGAKPTALLLDADNKVATLYKAKTTPHMFVIDKTGAVVYEGAIDDKPTNK
    VEDIQGSKNLVAAALGDLKAGRKVATPFVTPYGCSVKYKDA

    >gi|16124504|ref|NP_419068.1| SCO1/2 family protein [Caulobacter crescentus CB15]
    MPRHRLVLILACVVGLAVAVGLAWNVGVFRSEPAVTVGGPFELVDQNGAPTSEKALKGKWSAVFFGFTYCPDVCPGTLQG
    LAAATDQLGPKAKDFQIVFISIDPARDTVKQMKAYLSAPYVPKATIGLTGTQAQVDAAAKAYRVYHAKVGDGVDYTMDHS
    TAIYLMDPKGRFKTVIPYNLPPDEIARRIKDAVREG

    >gi|16124597|ref|NP_419161.1| dihydrolipoamide dehydrogenase [Caulobacter crescentus CB15]
    MARPEGDRPMAQYDVVIIGGGPGGYNAAIRAGQLGLKVAIVEGRGKLGGTCLNVGCMPSKALLHASELYAAATGPEFAKL
    GIEVKPKLNLSQMMAQKAESVEALTKGVEFLMKKNKVEYVKGWGRIDGVGKVVVKAEDGSETTLETKNIVIATGSEPTPL
    PGVSVDNKRIIDSTGALSLPEVPKRLVVVGAGVIGLELGSVWKRLGAEVTVVEYLDRILPGTDTEVANAFQKILVKQGFK
    FQLGAKVTGAEAGAKGVKLSFEPVAGGEAQTIEADYVLVAIGRRPYTQGLGLETVGVTPDKRGMIANDHFKTGVAGVWVI
    GDVTSGPMLAHKAEDEGVACIEMIAGKAGHVNYGIIPGVVYTSPEVATVGKTEDELKAEGVAYKVGKFPFLANSRAKINH
    ETDGFVKILADAKTDRILGAHMIGPNVGDMIAEYCVAMEFGGASEDVARTCHPHPTRSEALRQAAMGVEGWTMQA

    >gi|16124629|ref|NP_419193.1| hypothetical protein CC_0374 [Caulobacter crescentus CB15]
    MTLDRRILIASGLALTAGPSVARARSLPPAPGDMVLGAATAPVQFVVYASPSCGHCAHWWTTELPAIRKTFIDTGKVRLV
    FREFLTPPNEFAAAGFLLARRVPGKYFEVLTTVFQKRETIFESGRLWEGLQAIAQQYGLTEAQFTTAMNDTKALDGVNTR
    FRRAIGEDQVEVTPTFFVNGAPYEGEADLAALSKIFALAAKG

    >gi|16124630|ref|NP_419194.1| hypothetical protein CC_0375 [Caulobacter crescentus CB15]
    MRSLLSRVTIVAALAASLAACSPKSAEVTAEDMVLGDPNAKVTVIEYASVACPHCATWNAEVFPAFKAKYIDTGKVKYVH
    RDALTGEPRLANAGAMLARCAGKDKYFQVTEALYRAQTNIFTSGDIRGELLTIAQAAGMNEAQFNSCLSDENAAKSAERI
    EKMMTDNNIRGTPTFEVNGKRLGGEEGGEQTLAQLDAAIAEASK

    >gi|16124912|ref|NP_419476.1| methylated-DNA--protein-cysteine methyltransferase [Caulobacter crescentus CB15]
    MTTQGFALFDTAIGRCGLAWSQSGLIGVQLPEATPGAAWARLRKRFPDAVEADPPPEVEAAIDRIRDLLAGDRDDLADIV
    LDQDGQSAFNLRVYAIARAIPPGETSTYGQVARALGEPGAARAVGKALGENPWPIVVP
    CHRVLGSSGTLGGFSGSGGGET
    KARLLTIEKARTSAAPTLFDLEFSVAPPRGG

    >gi|16124942|ref|NP_419506.1| methylated-DNA--protein-cysteine methyltransferase [Caulobacter crescentus CB15]
    MRGRCGGPFFVKGGPVFPPLIRPSGPPSPARGEGRNYRADSRARLGDHRPMPRPAHLFLDRAPSPLGDLLIVTDETGLLR
    AVDFHDFEPRLRRLARLHYGDLVLETGPAPAAIKAAFARYFAGDLAALVSLAWATNGTPFQQAVWTALTQIPAGQTITYS
    ELARRAGRPLAIRAAGAANGANPLSLVAP
    CHRVIGTDGALTGYAGGIDRKRWLLAHEGAL

    >gi|16124962|ref|NP_419526.1| ada regulatory protein, internal deletion [Caulobacter crescentus CB15]
    MTAPTYPDDDARWNALRAKDRAAQGAFYIGVRTTGIYCVASCGGRPLRKNVDFHATREAARAAGLRACLRCKPDLDRETL
    RWGVVQTSLGLALIARSDAGLRLVALGDDVESLRGDLETRFKQARLIPDTAGLAADLAAVATLVDHPEQRPDLPLDALGT
    DLQKAVWAALRRIPAGRTVSYADIAHAIGQPKAFRAVAQACGANPLAVITP
    CHRVVRSDGGLSGYRWGVARKRALLAREA
    A

    >gi|16125082|ref|NP_419646.1| glutaredoxin 3 [Caulobacter crescentus CB15]
    MAKVTIYTRPFCPYCSRAVALLTDKGADFTEIEAGMDPALRQEMMQRSGRNTFPQIFVGEQHIGGCDDMMALEDQGKLDS
    LLSA

    >gi|16125168|ref|NP_419732.1| organic hydroperoxide resistance protein [Caulobacter crescentus CB15]
    MTTLYTTRATVVGGREGHARTEDGLLDVQLSMPKSLGGKETGTNPEQLFAAGYAACFQSAMGHVARTQKIALAGSTVTGQ
    VSLATAEVGFRLEVALEVETQGLSQADAEALVAAAHAV
    CPYSNATRGNIDVAITTKAA

    >gi|16125246|ref|NP_419810.1| methionine sulfoxide reductase A [Caulobacter crescentus CB15]
    MLSLHKTLEMPSADTALPGRAAPIPTAQTHFVNGHALKGPYPEGLETAIVAMGCFWGVERVFWKVPGVYVTAAGYAAGIT
    PNPTYEEVCTGRTGHTEVVLVVFDPKVVTYEALLKTFWENHDPTQGMRQGNDIGTQYRSGLYVTSDAQAAAAAESKAAYQ
    QALSARGLGTITTEIAPAGPFYFAEDYHQQYLAKNPNGYCGIGGTGVVCPIGLGVEG

    >gi|16125291|ref|NP_419855.1| peptide methionine sulfoxide reductase [Caulobacter crescentus CB15]
    MRRLIVLFAAALAVLGATAPALAAPKTETAVFAGGCFWCMEHDMQGVPGVLKVESGYTGGHLKNPTYRDVTSETSGHYEA
    VRVTYDPAKLDYGFLLYRYWRLVDPTDDGGQFCDRGPSYRPAVFVTPAQRPIAEKSRTEAAKRLKTGTMKTQILPAQTFY
    LAEEYHRDYAKRNKLNYFAYRTGCGRDARLKQVWGG

    >gi|16125656|ref|NP_420220.1| cation transporter E1-E2 family ATPase [Caulobacter crescentus CB15]
    MSHSLALHRDLEAFVRRDDAGRGRFELLVRGARCAGCISKIEKAVRALPGVEAARLNLTTGKLSVELAGKISDPGRVLET
    VEDLGYRACLFDPAEAEAAQDKEGKELALALGVAGFGAGNVMMFTVPAWAGLFGQELTPATLTLMYWMAAIVATPCALFA
    GRPFFRSAWASLRRGKANMDVPISIGVILTLIVSFSETLLGGKHAYFDAAVTLLFLLLIGRYLDHRLRAGARSAARDLLA
    LQAPVARRLTDGVEQGVPVADIRVGDLLAVAPGERIPVDGLVEQGASELDNALITGETALAPVAAGARLHAGALNLSGRL
    VMRASARSEDSTLAAIARLMEAGAQARSTYVRLADKAAALYVPVVHTAAALTFVGGWALGLGPREALLRAAAVLIVTCPC
    ALGLAVPAVQIAASSRLFRRGVLVKSGAALERLAEADHVVFDKTGVLTQGRPALIDAPAHLVAQAAPLARASRHPLARAL
    AAEAGAGPVAQDCVETAGQGVEGVIDGRRARLGRAAFVGVQAGDVRETELWFGFENNVKIRFAFEDRPRADARDTITKLR
    ALGLSVEILSGDVEGPVRDVAREVGVSDWRAGLTPVEKAAAIDALKAQGRKVLMVGDGLNDAAALSKAHASMAPGAAVDA
    AQNAADLVFTGDELAAVVESIETAREARRRALENFGFSALYNLVATPAAMFGLVNPFVAALAMSGSSIVVLLNAARPRLR
    SFNR

    >gi|16125674|ref|NP_420238.1| rhodanese family protein [Caulobacter crescentus CB15]
    MSTPSDPLVTTAWLAQHLEAPDVRVVDASWHMPAAQRDPHKEFLAAHIPGAVFFDIDEIADESTDLPHMIPSPTKFASRV
    RKLGLGDGSRIVVYDSTGILPAARVWWHFRAMGHEDVVVLDGGLPKWISEGRPIEDGPAFPQERHFTPRYQADVYRSLDQ
    MRDIVATGREQIVDARAAGRFEGVDPEPRAGLRGGHMPGARNIPLSALIAPDGTMLSAEKLKSVFEAAGVDINKPVVST
    C
    GSGITASVVALALARMGKPRSAVYDGSWTEWGGLADTPVVTGPAQ

    >gi|16125750|ref|NP_420314.1| arsenate reductase [Caulobacter crescentus CB15]
    MTDIAFPITIFHNPACGTSRNTVAMVQAAGYAPQVVEYLKTGWTREQLQDLAAKSGGSLRALMREKGTPAETLGLLADEV
    SDERLLDAMVEHPILVNRPIVVTPKGVKLCRPSEQVLDLLDRKPEQFTKEDGEVVTP

    >gi|16125888|ref|NP_420452.1| hypothetical protein CC_1642 [Caulobacter crescentus CB15]
    MAGRGQASIRPGTDLVMTPTLYGIKNCDTVAKARKWLDDHGRSYAFHDYKATGIDRPRLEAWVAEVGWEVVLNRAGTTFR
    KLPDADRQDLDAAKAVDLMLAQPSMIKRPILDLGDRRVVGFKPDWYAAAFG

    >gi|16125919|ref|NP_420483.1| bacterioferritin comigratory protein [Caulobacter crescentus CB15]
    MKIVLAGVAAVALAFASPALAALKAGDKAPDFSAKGALAGKDFDFNLAKALKKGPVVLYFFPAAYTAGCTAEAREFAEAT
    PEFEKLGATVIGMTAGNVDRLKDFSKEHCRDKFAVAAADKALIKAYDVALAVKPDWSNRTSYVIAPDGKILLSHTDGNFM
    GHVQQTMGAVKAYKAKK

    >gi|16125974|ref|NP_420538.1| glutathione peroxidase [Caulobacter crescentus CB15]
    MAMSIYDYSAKTLDGQDVSLADYRGQVLLIVNTASKCGFTPQYEGLEALYKAHKDRGFTVLAFPCNQFGAQEPGNAEEIA
    NFCSLTYDVSFPVMSKIDVNGADAHPLYKFLKKEQKGVLGTEAIKWNFTKFLIGKDGQVVDRFAPTVKPEDLKVAVEALL


    >gi|16125975|ref|NP_420539.1| pyruvate dehydrogenase complex, E3 component, lipoamide dehydrogenase [Caulobacter crescentus CB15]
    MSTEFDVVVIGAGPGGYVAAIRASQLGLNTAIIERENLGGICLNWGCIPTKALLKSGEVYEQLSHLGGYGLSVEKASFDF
    GKIIERSRGVAKNMSGGIAFLMKKHKIEVIEGEAKLEKGAPAPKVVVALKAGGSRTVQAKNVILASGARAREIPAIGAVS
    DGDKIWTYRDALAPKSMPKSLVVIGSGAIGIEFASFYRALGAEVTVVEAIDRIMPVEDEEVSKAAQKAFEKRGIKFRVGA
    KVSKIEKTKDGVAVTVEAGGKIEQLTAEKCIVAVGIAPNNDGLEALGVSLDRGHVVTDKHCRTNVPGLYAIGDIAGAPWL
    AHKASHEGIHAAEAIAGYKTPNVLSPIPGCTYANPQVASVGYTEAGAKAAGIEVKAGRFPFRVNGKAVASGETEGFVKTV
    FDAKTGALIGAHMIGHEVTEMIQGFVTAITLEATEEDLHGVVYAHPTMSEAMHEAALDAYGRVLHI

    >gi|16126086|ref|NP_420650.1| hypothetical protein CC_1843 [Caulobacter crescentus CB15]
    MSQPQAMIIDVVADVVCPWCYLGWRRLKSAIALRPDLKAQLIWRPYQLDPTLPEDGVDRKAYMAQKFKDPEKLKAVHTAL
    VEGGAEEGIVFNFEAIALSPNTNAAHRLIRWALTAGVQDHVVEALFKAYFEQGLDIGDPIVLGDIAEAAGMERLVVLQLL
    SEGADKEAVAREHAMAVQGGVTGVPFAIFAGKVAVVGAESPERIAQAIDQALAA

    >gi|16126101|ref|NP_420665.1| HesB/YadR/YfhF family protein [Caulobacter crescentus CB15]
    MKEIMDKADQPYAGLRVGVKNGGCAGQEYVFEYAKEKGPIDEVVEDKGVTILIEPKAVLFLVGTEIDYEVTKLSSKFVFH
    NPNETDACGCGESVTIQPAAEALD

    >gi|16126114|ref|NP_420678.1| bacterioferritin comigratory protein [Caulobacter crescentus CB15]
    MLQPGDKAPDFDLPTDTGRVSLSALKGKNVVLYFYPKDDTAGCTSEALQFSSEVEEFQKLGAVIIGVSKDSAASHAKFRA
    KHDLTIELAADTLGDVVESYGAWVEKSMYGRKYMGIDRSTFLIDREGVIREIWRKVKVPGHIKAVMNAAKAIK

    >gi|16126122|ref|NP_420686.1| hypothetical protein CC_1879 [Caulobacter crescentus CB15]
    MTMLRRAATFAVPLAIAGLTLAGCDQSKPDKAFGEKVRAYLLEHPEVLMEASQKLQEKQAAQQAVSSQKAIGEYRQAIER
    DPRDIVINPAGTITVTEFFDYR
    CGYCRQATPAVLELVQKNPDIRLVLKDFVIFGNDSEAAARIALGAKDQGKSLELHKAL
    MAENALDARGALRIAERLGIDMDKAKAVGESQAITQHLADTDALARALNLSGTPAFIVGDTLVPGADIDALKLAIEQTRA
    ARAKAG

    >gi|16126252|ref|NP_420816.1| HesB/YadR/YfhF family protein [Caulobacter crescentus CB15]
    MTQIDLTLSENAARRIKAIGEAEGRALMLRVAVDGGGCSGFQYRFDLVDSVEDDDLKVERDGAAALVDVVSLALLKGSEI
    DFVDELAGAEFRIRNPNAKSSCGCGVSFSI

    >gi|16126422|ref|NP_420986.1| methionine sulfoxide reductase B [Caulobacter crescentus CB15]
    MTDAATLSTAGFDLTPPTEAERERLEANLTAEEARVLLHHGTEAPFCGGLLGEKSPGVYGCRLCGLPLFKHETKFESGTG
    WPSFYAPFAEDHVVGVRDTSYGMVRIETRCARCDSHQGHVFPDGPAPTRLRY
    CINSVSLQFVKAGAPLPDPLHRGDKIT

    >gi|16126449|ref|NP_421013.1| thiol:disulfide interchange protein [Caulobacter crescentus CB15]
    MNEVQSGQNGEEAKKRNPMRMALAGVILLGVAAVLYVIASASFKPSGPADLTEFKKGAFEKLDVPATPRPAPTTVFTSMD
    GKPTTLADFKGRVVVMNLWATW
    CAPCKAEMPTLAKLQAAYATQPVTVLPISVDRDSDLNLVREEMAANPPLVTYRDPSYK
    LSFDLQPRAQGYPTTIIYDRQGRERARLAGPADWSAPEVRGIVEKLLAEK

    >gi|16126541|ref|NP_421105.1| glutathione reductase [Caulobacter crescentus CB15]
    MADYDFDLFVIGAGSGGVRAARLAALSGAKVAVAEEYRVGGTCVVRGCVPKKFMVYASEVTSQLKTAKGYGWTIEDARFD
    WKTFLHEKDVEIARLSGIYVTNLQKAGAHLLHGRAQIVDAHTVEVLPKDGSDDAGTYTARKILVATGGRPVRPVFPGAEL
    GITSDEAFHLPTLPKSVLVVGGGYIAVEFAGIYAGLGVQTTLLYRGANILRGFDDDVRMHLADELEKRGIKVVLGCSHKS
    IEKLDDGRLLSTLSNDLTFETEAVMFATGREPYVQGLGLEKAGVKLNDKGAIAVDKYSKTNVDSIWAVGDVTDRINLTPV
    AIREGAAFAQTEFYGNPTTFDHDLVASAVFSQPPVGAVGMSEAEARQAFGKVDIYRSIFRPMKVTFYGGQERCLIKLVVK
    QDDERILGVHVVGPDSPEIIQMAAIAVKMGVTKPQWDSTCAVHPTLAEELVTMREKYVPAEVGGAG

    >gi|16126744|ref|NP_421308.1| glutaredoxin-related protein [Caulobacter crescentus CB15]
    MTDAATSPALDFIAKTVADHPVVVFMKGVPDQPRCGFSSVVVQILDHLGVEFVGVDVLQDEDLRQGVKTFTDWPTIPQLY
    VKGEFIGGSDIVREMFQSGELKTFLTEQGVIAA

    >gi|16126960|ref|NP_421524.1| hypothetical protein CC_2727 [Caulobacter crescentus CB15]
    MGKSALVAALRHDQKVRTDMRRPATTAHLHRMVMPGHTCPYGLKALDLLKRKGFKVEDHLLTTRADTDAFKAREGVLTTP
    QVFIDVSAVSANETD

    >gi|16127095|ref|NP_421659.1| rhodanese family protein [Caulobacter crescentus CB15]
    MTPQTTTPLTPDDAAQRLADGRAVLVDIREPDEFARRRARGALSRPLSTLESQGLGLPDAREVIFTCRTGMRTGANGQRL
    AQVCGGRAYVVEGGLDAWDAAGLPVDHNAKAPLEMMRQVQIGAGVLVLIGVVLGLLVSPLFFGLAGFVGAGLTFAGVTGF
    CGMARLLALAPWNRPAVA

    >gi|16127103|ref|NP_421667.1| thioredoxin reductase [Caulobacter crescentus CB15]
    MSPLRRIHTISPPMSTLSPRQTRCLIIGSGPAGYTAAIYAARALLKPVLIAGIQPGGQLTITTDVENYPGFADVIQGPWL
    MDQMRAQAEHVGTEFVSDIVTSVDLSKRPFTVKTDSGQDWIAETIIIATGAQAKWLGLESEAKFQGFGVSA
    CATCDGFFY
    RNKDVIVVGGGNTAVEEALFLTSFASKVTLVHRKDELRAEKILQERLLAHPKIEVIWDSVIDEVLGQTDPMGVTGARLKN
    VKTGETQEVAADGVFIAIGHAPSSELFAGQLETGSGGYLKVKPGTASTAIEGVYAAGDVTDDVYRQAVTAAGMGCMAALE
    AVRFLAEEDHKAAHHPISHAEANKIGVW

    >gi|16127148|ref|NP_421712.1| alkyl hydroperoxide reductase subunit c [Caulobacter crescentus CB15]
    MSLINTEIKPFTAQAYKDGKFVTVSEADVKGKWSVFFFYPADFTFVCPTELEDLADNYDVFTRLGVEIYAVSTDTHFSHK
    AWHDSSPAIGKIKYTMVGDPSGQVTNNFEIMRPGVGLADRGTFLVDPQGVIQFMEVTAEGIGRNAIELLRKIKAAQYVAA
    HPGEVCPAKWEEGEKTLAPSLDLVGKI

    >gi|16127149|ref|NP_421713.1| alkyl hydroperoxide reductase subunit f [Caulobacter crescentus CB15]
    MLDAGLKAQLTTYLQNLRQPITLVASLDDSKGSVDMRALLDDVASTSDKVSVRFDGDDARKPSFAIERAANDAEVRFAGL
    PLGHEFTSLVLALLHVGGHPPRIDAEVIERIKALDGDYQFETYFSQS
    CQNCPDVVQALNTMSALNPRIRHVAIDGALFKA
    EVEARQVMAVPTILLNGQAFGQGRMEIEQILAKLDTGAADRMAEKIRAKDAFEVLVVGGGPAGAAAAIYAARKGIRTGVA
    AERFGGQVLDTMDIENFISVPHTEGPKLASALEQHVKDYEVDVMNLQKAVGLVPAKTPGGLHEIKLENGANLKARTLILS
    TGARWRNVNVPGEAEYKNKGVAY
    CPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVAHVTLIEFDSQLRADAVLQRKLA
    SLPNVTIIKSAMTTEIHGDGSKVNGLTYKDRTSDTAHRVDLEGVFVQIGLVPNTEWLKDSGVALSPRGEIEVDYRGETSI
    PGVFAAGDATVTPYKQIIIAMGEGAKASLSAFDYLIRLPASEAAEAA

    >gi|16127228|ref|NP_421792.1| hypothetical protein CC_2998 [Caulobacter crescentus CB15]
    MNGAGRSASFSAPFKDPPMTDTPTRPFATATDSGHGGLQTFVTAGPATIVADLSAAQGGLDLGPDPHELVAAGLAACTTM
    TLRLYANQKGWDISGLHVEVFSSFDKETTPHERFERIITLEGDLTDEQRERLFQIAEK
    CPIHKLLTAGAKVVTTVAGN

    >gi|16127596|ref|NP_422160.1| hypothetical protein CC_3366 [Caulobacter crescentus CB15]
    MEARMSFVSAIPAAAPEVAAAHFAARLSLETDCADVAAAMRAGEVDFVLLHVVGAPQAYARRHVPGALHLRHAEISAERM
    SAWPADTLFVVYCAGPH
    CNGADQAALKLARLGRPVKLMIGGITGWADEGLPFAEGAEPGSL

    >gi|16127624|ref|NP_422188.1| AhpC/TSA family protein [Caulobacter crescentus CB15]
    MAIKVGDTLPAATFMTSTAEGPAPISTDDIFKGKTVALFAVPGAFTPTCSAKHLPGFKEKADELKAKGVDSIVCVSVNDV
    FVMKAWGKDQGIDGEVLLIADGNGDFTKAIGLDFDGSKFGMGARSQRYSLVAKDGVVTQLHVEDAGQFKVSSAEYLLEQL


    >gi|16127769|ref|NP_422333.1| thioredoxin [Caulobacter crescentus CB15]
    MSTVAVTDATFEADVLKSSKPVLVDFWAEWCGPCKQIAPALEQLSEELADVVTIAKVNIEDSPTTPSRYGVRGIPTMMLF
    RDGQMTSMKVGAMPKQKILEWLNEAGVQAA

    >gi|16127904|ref|NP_422468.1| thiol:disulfide interchange protein CycY [Caulobacter crescentus CB15]
    MKRWLAFSPLIVLVALAVLFAGYALQRDPRVQPQALVGKPMPALMLPDLDTGRPAPLRQTGEGPILVNFFASWCAPCEVE
    HPQLMALKAQGVTVVGIAYKDAPANTQAFLTRLGDPFAAKRVDRDGRAGLEFGVTGVPETYLVGSDGVIIAKHTGPLTPD
    AAEDLLKQAK

    >gi|16127928|ref|NP_422492.1| alkyl hydroperoxide reductase D [Caulobacter crescentus CB15]
    MSIEALRARLPDYAHDLGTNLALLVDDPALDPEARWGCFVASACAVGEPQTLRAIDAAATAAGLTAEANRAARKAAAMMA
    MTNVYFRAVHLMEGAAYQALPCRLRLNRLAHAGARGVTYDLSCVAVSAINGCGA
    CLDSHEADLRGRGVEPTQIQAALRIA
    AVVSAVARTLAAEAALHPQNLEI

    >gi|16127956|ref|NP_422520.1| molybdopterin biosynthesis protein MoeB [Caulobacter crescentus CB15]
    MWRGRGGGSSAMSFSDGEVERYARHLVLREVGGPGQQKLKAARVLVVGAGGLGAPAALYLAAAGVGTIGLVDPDIVSLSN
    LQRQVLYATGDVGRPKVEAASEHLRTLNPNTSVETHPVWLDASNAQAVVSGYDLVLDGTDDFATRFAVSDACVVQGKALV
    SGALGRWTGQVGVFHGQPCYRCLVPDIPPDAET
    CALVGVVGALAGVIGSMMALEAVKLITGAGEPLSGRLLIYDGLAGET
    RTVRIGRDPQCPSCGA

    >gi|16127959|ref|NP_422523.1| ada regulatory protein [Caulobacter crescentus CB15]
    MTMAYDASSLSDAISEAARQELARLAERSVDYHRMAKALDWLAERWSDHPPLDDAAQAVGLSPFHFQRIFTRWAGVSPKT
    FVSAIAHAEARRSLEAGGTVLDAAFDAGLSGPSRLHDLFIAQEAATPGEVRRRGAGMRLRWGWAPTPFGRGLFVMADRGL
    AGLAFSDGDDEASFADMHRRFPAADWSRDDLAAQATALHAFAGGEGPLPVVLIGSPFHVQVWKALLRIPTGETATYGQVA
    AWAGKPKAFHATGGAIGANPISLLIP
    CHRAIAKDGRLTGYHWGLARKAAMLGMEAVAAAS

    >gi|16127896|ref|NP_422460.1| hypothetical protein CC_3666 [Caulobacter crescentus CB15]
    MRSMRKAALSLFSLVLSGVVATLSWGGVAWAQKPPVVVELFTAQGCSSCGKANQVAADLAKQDGVLALTYAVDYWDYLGW
    KDTFAKPVFAERQRAYAKKFALRDVPTPQMVVAGRVQASGTKAEAVEDLVKTAARARLNPPDMQFIGAARVAVGSGPAPR
    GGGEVWLVRYDPREQDIAIKRGDNKGQTLVHRNVVRELVRLGPWAGKPKLYRLPAANDADLVTVVLVQGAKGGRILGVLQ
    SAGEAKR

    >gi|16125027|ref|NP_419591.1| monooxygenase flavin-binding family protein [Caulobacter crescentus CB15]
    MTGKLPKACVIGAGCSGFTTIKRLKDYGIPYDCFEMSDEVGGNWYYKNPNGLSACYESLHIDTSKWRLAFEDFPVPKDWP
    DFPHHAQLFQYFKDYVDHFGLRPTITFNTKVESAKRTADGLWAVTLSGGETQFYDVLFVCNGHHWDPRVPEYPGEFDGPA
    FHAHAY
    CDPFDPVDMRGKNVVVVGMGNSAMDIASELSQRPIAKNLWVSARRGVWVFPKYLNGKPADKTALPAWMPRKLGV
    ALSRSVLKKTIGRMEDYGLPKPDHEPLEAHPSVSGEFLTRAGCGDIKFKPAIKALEGKRVRFTDDSVEDVDAIVFATGYK
    ISFPFFDDPALLPDADHRLPLFKRMMKPEVPNLFYMGLAQPLPTLVNFAEQQAKLAAAYLAGQYALPPPAEMARITAKDE
    HRHTGHFYDSARHTIQVDFNVYCADLKKEIAKGEARARNAGGKLPVAARAEGQALAAE