Catenulispora acidiphila DSM 44928 uid59077

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|256389446|ref|YP_003111010.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Catenulispora acidiphila DSM 44928]
    MHDIYTLPADLPIPQDDGAADHLPGARVPELTLTSTAGEAIALAALGEGRTVLYIYPLSGRPGEEAPEGWSAIPGARGCT
    TEACDFRDHHKELLEAGAARVFGLSSQDSAYQQELVERLRLPFAMLSDTGLRLAAELDLPTFEAGGRLLYKRITLVIRDG
    VIEHAFYPIFPPDRHAGEVLGWLTKNPVRRIP

    >gi|256389474|ref|YP_003111038.1| Rhodanese domain protein [Catenulispora acidiphila DSM 44928]
    MLATTDVNALPEGGLLLDVREDDEWAAGHAPTAQHIPMSEFAARKDELGTPEGPVYVICRAGSRSAQVAQYLSQNGVEAV
    NVTGGMQAWEAAGKAVVTDSGAAGIVI

    >gi|256389764|ref|YP_003111328.1| selenide, water dikinase [Catenulispora acidiphila DSM 44928]
    MSVDVEQPSGEVTRRLTQYAHGGGCACKIPPGELESVVAQLAAAEPAKSPYELLVGLETGDDAAVVRLTGDTAIISTADF
    FTPVVDDAYDWGRIAATNALSDVYAMGGTPVTAVNLLSWPRDVLPLELVAEVLRGCLDVTRAAGCHLAGGHSVDDPEPKY
    GMAVTGVADARRLLRNDAATPGLPLTLTKPLGIGVLNSRHKATGEVFPQAVDAMTTLNADAATAALAAGATCATDVTGFG
    LLGHLYKLVRASGVTAVIDPGAVPYLEGARRAALDGFVSGGTRRNLAWVNEHVAWGSGVDEVERLLLADAQTSGGLLIVG
    EVPGFPVIGELVLAGPRSLVIG

    >gi|256389916|ref|YP_003111480.1| protein of unknown function DUF255 [Catenulispora acidiphila DSM 44928]
    MNRLASATSPYLLQHADNPVDWWPWGEEAFAEARRRDVPVLLSIGYAACHWCHVMAHESFEDEATAALMNEKYVCVKVDR
    EERPDVDAVYMAATQAMTGGGGWPMTVFATPEGKPFQAGTYYPPVARHGLPSFRQLLVAVDRAWGDIREDVLRAGDGLVA
    ELAHHARVVAGAEGVPDAGALATAVGVLRREFDGVRGGFGGAPKFPPSMTLEQLLRHHARTGDADALAMVRQTCEAMARG
    GMYDQLGGGFARYAVDDAWVVPHFEKMLYDNALLLRAYLHLWRATGDALALRVVNETADWMLRELWLDGAGGFASSLDAD
    TDGVEGKFYAWDAEQIADAVGEKEAGDAGDAAWAAAVFNVTAQGTFEHGLSVLQLLQDPDDLDRFQRIRDSLFEARRDQR
    TAPGRDDKAVAAWNGLAVAALAEAGALTGRQELVSAARQTAEMLERIHWDGKTMRLTRTSRDGVAGAQNPGVLEDYADVA
    EGLLALYAVTGETRWFAFAGRLLDVVLDNFRDDSGLFYDTADDAEALIFRPADPTDNATPGGTSAAAGALLTYAALTGSG
    RHREAAEQALHFTGALAEKAPRFAGWGLAVAEALADGPREVAIIGEWNGEWNGEWGGDAASAEEGAETATSQAFQALHLA
    ALRSAAPGLVVAVTPPTGAAQPAHGSGTENLPELLSDRSTINGEPAAYVCRGFVCQTPTTDVTEMTAQLA

    >gi|256390077|ref|YP_003111641.1| Redoxin domain protein [Catenulispora acidiphila DSM 44928]
    MNFTILDDHRDVAVDARIAGDGRVLIPIAEVPGALGWERKPQGWCRGDICIPARVAAGVERDGNFVDLAAFAELVDRPYA
    AVPGLGVAAVGASAAERASALAEGEAPDFELRDVAGVAHRLSDLRGRKVALVFWASW
    CGCRYDLPEWERQHVALSPEGFS
    VVSVAIDRRPADAEPWIKEAAATHPALIDADGTVADRYQVLNVPTVVWIDEEGRIARPNDTQFATDLFRSMSGLDSARAM
    AALERWVRNDDSGLTADDVATYAPQVTAAQQQARTEAALALWLHRAGHPTEAAAHFAEAERLAPEDVTIWRGSMPLLGAD
    PMGDEYFTRREALADAGIPIYRPLPDWQGATKE

    >gi|256390220|ref|YP_003111784.1| Glutathione peroxidase [Catenulispora acidiphila DSM 44928]
    MSLYDIPINTLDGKPASLKDYEGKTVLLVNVASRCGLTPQYEGLERLHERFADRGFTVVGVPCNQFGGQEPGTSEEIQEF
    CSATYGVTFPLTEKIDVNGDERHALYTELTKATDAEGGNGDIQWNFEKFLIGSDGTVLKRFRPRTEPEAAEVVEAIEAAL
    PA

    >gi|256390478|ref|YP_003112042.1| thioredoxin domain protein [Catenulispora acidiphila DSM 44928]
    MRQRPQIPGMAAGGGPGLPASALRGVVDLGALAAKPQAAPAATAQGPGAGTGGEGSGPAGGGTDAIASPLVFDTSDATFD
    TDVIERSLTVPVVIDFWAEW
    CGPCKQLSPLLERLTVEYGGRFVLAKLDVDANPALAQEFGIQSIPMVMAVVGGRLVPLFP
    GAVPEAQVRRYLEELLRLAAENGVTGTADGQAPEELPEPPMDPALAAAYTALEENDLDGAAQAFRNVLNANPGDTEAKLA
    LAQVELMLNTRDLDVDQVRADAEAKPDDAAAQIAAAELDLSTGRVDEAIDRLVGFVARSAGADRDAARVKLLDFFELLGP
    EDPRTATGRQKLTRVLF

    >gi|256390542|ref|YP_003112106.1| thioredoxin [Catenulispora acidiphila DSM 44928]
    MSTVELTKDTFEQAVTSDGIVLVDFWADWCGPCKQFAPIYNKVSEANPDITFAKVDTEDQPELAGAFEIRSIPTLMIFRD
    GVMVYGQPGALPEAPLVDLIKQARELDMEEVRKQIAAQQNGGHEGSDAQA

    >gi|256390643|ref|YP_003112207.1| Rhodanese domain protein [Catenulispora acidiphila DSM 44928]
    MTTLITRDELQAAISAGHVTLLDALAGTYWQKQHLPGAIPLHADHVEQVYRELLPDRNALIVTYCTNPACQNSQQVATKL
    ETLGYTNVRKYREGIEDWAAAGLPLESGDGEG

    >gi|256390758|ref|YP_003112322.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Catenulispora acidiphila DSM 44928]
    MSSPNGPPDGGPSIHPPSSPVPSDPVGSSGSGTGGPGTGGFGTGGPEPASEPGSQDRAEQPPPPRAGDRAPVFTLTDQHG
    QSVSLTDFRGKQAVLLVFYPFAFSRV
    CGSELQAIHESVEDFQNERVQVLAASCDALYSLRAYADEAGFGFPLLADHWPHG
    GAARAYGVFDAERGCAVRGTFLIDHEGVVRWTVVNGLADARSLDDYRAALAAAGV

    >gi|256390862|ref|YP_003112426.1| iron-sulfur cluster assembly accessory protein [Catenulispora acidiphila DSM 44928]
    MTVQTETSQEATVAQGIILTAEAASKVKSLLEQEGRDDLSLRVAVQPGGCSGLRYQLYFDDRSLDGDVVAGFDGVNVVTD
    RMSAPYLEGATVDFVDTIEKQGFTIDNPNAGSSCACGDSFS

    >gi|256390974|ref|YP_003112538.1| Rhodanese domain protein [Catenulispora acidiphila DSM 44928]
    MRQPGTAPSSSDSPLTSVDQLAADLACGTAPILLDIRWKLGEPSEYGHGVYLKGHIPGARYVSLDQDLAEHPDSPVGARG
    RHPLPDRERFAAAMRHAGVRADLPVVVYDDGDGTQAARAWWLLRHHGHAEVRVLDGGFAAWRAAGRTVEEGEPEAEAAEG
    DFEASGDGVFTVLDHDGAAAVAADGTLLDARAGARYRGETEPIDPAAGHVPGAVSAPTTENLGADGRFLPSEALAERFAG
    LGVEAGHAGAVAVY
    CGSGVTATHEILAMAVAGIDPEGVALYEGSWSGWASDPSRAVATGEG

    >gi|256390993|ref|YP_003112557.1| Heavy metal transport/detoxification protein [Catenulispora acidiphila DSM 44928]
    MTAVAETGTPAVAYGVLGMSCGHCSAAVTEALSALPGVAAVEIDLPGKRALVTSAAALEIAAVRDAVEGAGYQLV

    >gi|256391028|ref|YP_003112592.1| dihydrolipoamide dehydrogenase [Catenulispora acidiphila DSM 44928]
    MAGDNQFDLVILGGGSGGYACAFRAADLGMSVALIEKAEVGGTCLHRGCIPTKALLHAGEIADNTREAAQFGVAATFHGI
    DMAAVNSYKDGVVGQLYKGLQGIVKARKIEFIAGEGKLVSANTVQVSTNNGSGGQNVTGSNVVLATGSVPKSLPGLEIDG
    NRVISSDHALKLDYVPASAIILGGGVIGCEFASVWKSFGTDVTIIEGLPHLVPLEDENSSKLLERAFRRRGIKYELGNFF
    SGVEYTENGVRASIANGKTVEADLMLVAVGRGPVSAGLGYEEAGVAMDRGYVKVDQYCRTSVPGVYAVGDLIPTLQLAHV
    GFAEGILVAEHIAGLNPAPIDYDGVPRVTYSHPEVASVGLTEAQAKGKHGEDAVKTFNYDLAGNGKSKILKTSGQVKVVQ
    QVDGPVLGIHMVGDRMGELVGEAQLIFNWEALPQEVAQLVHAHPTQTEAMGEAMMALAGKPLHVHD

    >gi|256391090|ref|YP_003112654.1| DSBA oxidoreductase [Catenulispora acidiphila DSM 44928]
    MRVEIWSDVACPWCYIGKARFEQGLQAFDHKDDVEVVFRSFELDPQRAKGDTVQVLPMLAGKYGMSIEQAKQAEARVAAN
    AADAGLGYLAEGRDHGNTFDIHRVLHFAKTRGKQNELLDLAYEANFADERSIFDDDRLIELAVKAGLDETEVRTVLADAT
    AFAADVRADEQEAQALGANGVPFFVLDRKFGVSGGQPAEVFTQALQEAWAAHTPALKLVGEAASPDGAVCGPDGCEIP

    >gi|256391223|ref|YP_003112787.1| thioredoxin [Catenulispora acidiphila DSM 44928]
    MAVVELTKDTFAETVEGEGITLVDFWAEWCGPCRSFAPVYQKAAGKHEDIVFGKVDTEAEQELAMAFDIRSIPTLMIVRD
    GVTLYQHPGALPESALEDLIAQARALDMDEVRKALAERAAEAEAQSADSTAADAESAAV

    >gi|256391674|ref|YP_003113238.1| dihydrolipoamide dehydrogenase [Catenulispora acidiphila DSM 44928]
    MSTHFDVVVLGAGPGGYTAAVRATQLGKTVAVVEERYWGGVCLNVGCIPSKALLRNAELAHTVQHEAKIYGISSNGPITF
    DYGAAYERSRQVADGRVKGVHYLMRKNKIAEYDGRGTFLDQNTLSVAKSDGTSETLTFDHCVIATGARTRLLPGTQLSER
    VVTYEEQILSATLPESIVIAGAGAIGVEFGYVLNSYGVKVTIVEFLERMVPLEDAEVSKELARQYRKLGVDVLTGTRVET
    IDDSGPKVRVTVSGKDGAQQVLEADKVLQAIGFSPNVDGYGLDKTGVALTERGAIAVDGRGRTNVAHIFAIGDVTAKVML
    AHVAETQAMVAAETIAGAETMEIDFVMVPRATYCQPQIASFGWTEEQARLEGFDVKIAKFPFSANGKAAGLGDAVGFVKV
    ISDAKYGELLGAHLIGPEVTELLPELTLAQQWDLTVHEVGRNIHAHPTLGEAVKEAVHGLAGHMINM

    >gi|256391756|ref|YP_003113320.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Catenulispora acidiphila DSM 44928]
    MDTMHADLLVIGFGKGGKTLAAKMGRLGRRVVMVEQSDQMYGGTCINIGCVPTKSLIHHAQTRPAGADPREWYAGSVAAT
    ASLTGAMRGKNFGMLDELDSVTVVTGTAAFLDEKTVEVTAGSDRLEITAETIVINTGAQNAVPDIPGLRASKHLVTATEL
    IGSPDLPRRLVVLGGGYQGIEFAAMLSTYGTEVTVLEAGVRILPREDEDVVGVVEQILTDDGVTVRTGVRVTRVEDTADG
    ALVHYEANGADGTAGTSGTLEADVVLSAVGRTPRTAELRLDAAGIRTTVRGAVEVDEHLRTNRPHIFAVGDVNGGPQFTY
    ISLDDSRIVADQLLGEGKRATSDRVAVPYTLFMGPPLARVGVTETEALATGRPVRIVSKAVAAMAAMPRAGIVGETRGVM
    KFVIAADTDEVLGAAILSVDSQELINTVALAMRSGVTASTLRDAIYTHPSSTEAFNEVLATVVR

    >gi|256391833|ref|YP_003113397.1| arsenate reductase and related [Catenulispora acidiphila DSM 44928]
    MEIWINTACTKCSSALFLLDLEGQEYTVRRYLNDPPSAAELEDVLSRLALEPWDIVRTDEPVAARLGLGSWERSAATRGR
    WIQALAFHPILIQRPIITADDGTAVVARTREAVRSVLPSTS

    >gi|256392268|ref|YP_003113832.1| Rhodanese domain protein [Catenulispora acidiphila DSM 44928]
    MSAVDTFLEEARSGLRRVSPQEADRLRREGALLIDIRPHANREAEGEIPGALPVERIHLEWRLAPDNEWRLPGVTADSQV
    IVF
    CNEGYASSLAARDLQLLGLVHATDLVGGFRAWAEAGLPTEAGGRPALP

    >gi|256392671|ref|YP_003114235.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Catenulispora acidiphila DSM 44928]
    MKHFDLVVIGSGSGDTVIGDRPAGWTVALVEDQAVGFGGTCLNVGCIPSKMFVHTADLAEDARAANAFGVDLPAPAVRWL
    AIRKRVFDRIDQRSADGLRDSRAGGPNLTLFEGKGQFTGPNTLLVNDGETISADRFVIAAGSRPIVPDVPGLQDAGFLTN
    ETIMRVEKLPERLVILGAGAIAAEFSHVFSALGVHVTVISRSGSMLTREDEDVSQLFTGIARRKWDLRQRREATRVERTS
    TGIRVHLRDPDGGDGDDVDDVESVQEFVEGDELLVAVGRRSNADRLNLSAAGVATHPDGRIAVDSRQRTNVPGIFAIGDV
    SSEHQLKHVANHEARVVAHNFSHPDEPTESDHRFVPHAVFTSPQIASVGLTEQRARAEGVPYVVGKRDYSEIAYGWAMND
    PEGFAKVLADPQTGRLLGAHIIGPQASVLIQPLIQAMSLGQDAATVARGQYWIHPAMSELVENALLDLPQRSAKSPVN

    >gi|256392679|ref|YP_003114243.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Catenulispora acidiphila DSM 44928]
    MVTLVLIGLVGGLITGISPCVLPMLPVLFFTGGAGGAGGAAAADAPRPGASRRPYLIVAGLVLSFSVFTLLGTLVVSALP
    VPKDIIRWAGLVVLVLLGIAMMFPRVEDLLERPFNRIPQRRVADEHGGFVLGLALGTVYVPCAGPVLAAITVAGASGRIG
    VGTVALTVAFAVGTAIPLLAFALAGRRVAERVRAFRNRQRGVRITAGVVVIALAVGLTFNVTDALQRAVPDYTSNLNAAL
    DKSGASHKLAPAGPAALAKCAEAQMSSLGDCGKAPAITGIQQWFNTDGGAALTPASLQGKVVLVDFWAYS
    CINCQRAIKH
    VQAWYSDYAADGLVVIGVQTPEYTFESDPGDVAAGAKRLGITYPVALDSKYTTWNNFGNESWPADYLIDSTGEVRFASIG
    EGAYPNTESLIRKLLTAAHPAGVSLPPATDIPDATPTDPDQTPETYLGAERANSLAPGEAGTFKTGTQTFAYPADVPDDA
    FALTGSWTVAAQSLTAGPGAGIRLNFMASKVYLDVGGTGTMTATVDGKSTSYPVSGAPNIYTLVNVGDSERSTLTVTLSP
    GLSAYSFTFG

    >gi|256392812|ref|YP_003114376.1| hypothetical protein Caci_3632 [Catenulispora acidiphila DSM 44928]
    MAGKAVVSLTTGLEDAERVTVAFLVAVGAAEQGRETLMFLTKEAVRLATDGVARAVACEGCPALDELVKRYESAGGSFLV
    CPICFTTRHLDEGSLVANAALGGTIPMWEWIGDEPATTFSY

    >gi|256393516|ref|YP_003115080.1| hypothetical protein Caci_4375 [Catenulispora acidiphila DSM 44928]
    MDLAGVAAAVGALAAASAFGLWRKRSDGTVRDESATAERLSAADLGIDLDPRATLVQFSSKVCRYCGPTRRVLTELADQH
    TVAYLDIDAEEHLDLARRLTVLRTPTVLLLDGTGRITHRVSGPPRRAELAAAVSALASLHQ

    >gi|256393589|ref|YP_003115153.1| methylated-DNA/protein-cysteinemethyltransferase [Catenulispora acidiphila DSM 44928]
    MNVYTDIESPIGTLLLVGERTPDGSVRLASVSMDGQRSAPKIGDGWVADAEAFAEVTRQLQEYFAGTRIEFDLAATITGT
    DFQRRVWDALDTIPHGTTTTYGALAAQLGLPRDRVQALGAAIGANPLLIVRP
    CHRVVGADGSMRGYAGGVERKQWLLASE
    GAIAPLLV

    >gi|256393642|ref|YP_003115206.1| hypothetical protein Caci_4502 [Catenulispora acidiphila DSM 44928]
    MPALVPAPTRLRRWGALSKIQQPGQAVGHDVAATGGVGVPVLIPSGTTDVAPRPAHPHVGAAAPARSGAAAAMAPASPRP
    APAPPTAQDPNLGYDPNAAATAQIVNAVAAAQRDGKAVLLDFGASW
    CTACRALDKAMHTPKAQAVLAHSYHVVKIDLGDA
    DPQHMSLATQYDALGTFGMPLLVVLNPDGTVRADSAHTGQPKYTEADMAAWLSQWAGR

    >gi|256393648|ref|YP_003115212.1| arsenate reductase and related [Catenulispora acidiphila DSM 44928]
    MEIWINPRCSKCRVAQETLDAAGVEYTVRRYLDEPPTAAELRDMLRRLGLEPWDIVRDGEQVAKDLGVKQWSRDGEADRE
    RWIAALAGHPILIQRPIITADDGHAVVGRSDEAVRSVLPRG

    >gi|256393707|ref|YP_003115271.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Catenulispora acidiphila DSM 44928]
    MEAPDENVVEAAQEMVAEGAPTFAHGAAPAVGDDGTADTIDPPDGEVFDVIVVGGGPTGENLADRAHAGGLSVAVVEHEL
    VGGE
    CSYWACMPSKALLRPVAAVADARRVDGAKQAVTGELDVAAILARRDEFTSNWKDDGQVDWLAKAGLCLVRGHARLD
    GERRVVVRTPEGTDRILNARHAVALCTGTQASVPDLPGVAEAKVWTSREATSAKHVPGRLAVIGGGVVAVEMAAAWRALG
    SEVTLLVRDDRLLTGMEPFAGELVAEKLAEDGVDVRFGESATAVRRQDDGTVDLTLAGGGTLTADEVLFATGRRPATADL
    GLDSVGLKPGSWLPVDETGLVQGVSGTWLYSAGDVNHRALLTHQGKYQGRIFGGAIADRAFGRELDTAPWGRSVATADVR
    AVPQVVFSDPEAAAAGLTLKQAQDQGLNVRAVDYDLGQVAGAALYADGYRGRARAVVDLDREVLVGVTFVGPGVAELVHS
    AAMAVAAEVPLSRLWHVVPAYPTLGEVWLRLLETYRG

    >gi|256394101|ref|YP_003115665.1| hypothetical protein Caci_4964 [Catenulispora acidiphila DSM 44928]
    MPHIDVGNDQPGIRSLFFYRPETAGPLSELAETLLRAPSSLERWERELIATHVSELNECRYCATTHAAFTSAQLPDGLDL
    TIIRADLGTAPISDKLKALLAIAAAVQQNGKEVTAELIDRARAVEATDLEIHDTVLIAAAFCMFNRYVDGLATTVPDDPD
    NYSTRAQALVRDGYLPVVELARAHQAARAL

    >gi|256394159|ref|YP_003115723.1| alkylhydroperoxidase like protein, AhpD family [Catenulispora acidiphila DSM 44928]
    MAILKKEAASGRVTLDVPCAATLGEPIVRPNLVRMVLRPLSFLQVRHVSPVRRGGVDARVAVIYGEMERLFGLISPPVVL
    HSPVPDLLAATWMMMSETLLVEGAVDRRVKEAVATAVSVGNECPY
    CVTIHGTMLRSLGHDADATALADDRVIDVADPEVR
    AVSAWVRASANAAGAAGDEVEPPFPPEQAAEILGVVLVFHYFNRMVNVFLPDAPLPPLAPAAVLTVVLPVLGRFLRSAHR
    NTAPVGGTLKLLPEAPLPTDLAWATDNRTISDALSRATAAYEQAGQRAVPAAVRDLVRAELAAWDGQPKGMSRAWVEEAI
    RDLPTADQPAGRLALLIALASYQVDEGALGAFRATAPGDATLVELASWASFTAAVRATGRMVVAKPVG

    >gi|256394196|ref|YP_003115760.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Catenulispora acidiphila DSM 44928]
    MSLNTELRAYYEARQQQIPADIRAVMDRAAADLAASGQTEQAPAVGEAAPLFTLPAVDGRSVALADALAQGPVVLTFYRG
    AW
    CPYCNMTLRALQAVNDDITARGAQLIAVSPQIPDESLTLAEKHALTFQILSDLGCQTAKLYGLSFDIPQDLSNLYDAL
    GFDLNRVNAGHARTLPLPSTFVIAPDGTITWTFVETDYTKRAEPSDILAALDRIRDTAAASAS

    >gi|256394339|ref|YP_003115903.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Catenulispora acidiphila DSM 44928]
    MDAACKTFRVQHRSHKTRLAVAISTATVLAVGLAACGGAGPKNAAGLGTAGAIAADHRKPFPVLSGTTLDGAQLDLSSYK
    GQIVVMNIWASW
    CDSCEAEAPYLEHAYETYKDKGVRFVGIDAGDDNTGQARAFVKAKQIGYPNLVDGVDEKLLTKLAGIT
    SLGSVPSTLIIDKNGDLAWRSLRPVDYNALSAALGPVIAEQ

    >gi|256394533|ref|YP_003116097.1| transcriptional regulator, HxlR family [Catenulispora acidiphila DSM 44928]
    MKYTRIGDTDCSIAQALDVVGDWWTLLVVRDVAGGVTRFSELAAELGVSRKVLTERLAMLVDRGVLERRQYSDRPARFEY
    HLTDAGRGLLPVLIALQNWGAQHVMGDGTLTATSEPASAEARRVHALVGTGLPALTLPDADRAPTDPVSAGAKWTVLYTF
    PGSPAVDPGLAPGWSDVPGGPG
    CTLEARTFRDRLPEFAAADAAVVGVCTQRPEQLARFAELESLPFPLLSDQALQLAAAL
    RLPTFRAAGADRLKRATLIVDAARTIRGVLYPVPDPAASVDEALRIVAGL

    >gi|256394683|ref|YP_003116247.1| methylated-DNA/protein-cysteinemethyltransferase [Catenulispora acidiphila DSM 44928]
    MQTALLDTPIGTLTVGATARGLRLVQFPHDREPDQPLAAADPAAKPDHIAQAQLDEAVLQLTEYFDGGRTQFDIALDWYG
    VNGLRLTVLKLLAEVPFGETVTYGDLAKGSGAGVTASQAVGGIMGSNPLPIVVP
    CHRVLAADGLGGFGGGLRTKEWLLAW
    EGVMPPALDWGV

    >gi|256394825|ref|YP_003116389.1| selenide, water dikinase [Catenulispora acidiphila DSM 44928]
    MLEEITYSESDEVAGVRLTQFARGGGCACKIPAGELESILGAVGATAFTGDHELIVGLDHGDDAAVVRLAGDTALVVTTD
    FFTPVVDDAYDWGRIAAANALSDVYAMGGTPVVAVNILSWPRDLLPMELVAEVLRGGFDVTRAAACHLAGGHSVDDAEPK
    YGLAVTGVVQADRLLRNDAGRPGTPLSLTKPLGIGVLNTRHKATGERFPQAVATMTELNRDASQAALAAGARCATDVTGF
    GFLGHLYKLARASGVTAVVDPAAVPYLDGAREAARDGYVSGGTRRNLDWVSPNVEWGSGVDELERLLLADAQTSGGLLVA
    GLVPGAPVVGELVEQREHAVVVA

    >gi|256395372|ref|YP_003116936.1| OsmC family protein [Catenulispora acidiphila DSM 44928]
    MTTVTNGVNVQALLDAREVLKGAPEAAQFTWRATSTWRDGVHSTTTVKDFFGLGEEHNHKTESVFEADHPAVFAAEDNGI
    TPIEYLLVGLAG
    CLTAGVASVAQNRGIQLRSVSSTVEGRHDIRGILGADSDVRNGFTDIKVSFSIDADASQQEIEALVAQ
    SQKRSAVFDALTNPTDVTVEVL

    >gi|256395514|ref|YP_003117078.1| Carboxymuconolactone decarboxylase [Catenulispora acidiphila DSM 44928]
    MSHIELGVDETLFPGISGPMLFRPQTAAPMSDLVEVLLRGENTLSRGERELIAAYVSSKNDCEFCTDSHSAFAAAQLDEG
    MPLVLRVRADPDEAPITPKLAALLRIAGAVAKSGREVTTELVGTARAQGATDEEIHDTVLIAAAFCMYNRYVDGLGTLPA
    GRAEDYQAAAEAVVANGYLPLAGRAPSALNVAAS

    >gi|256395537|ref|YP_003117101.1| peptide methionine sulfoxide reductase [Catenulispora acidiphila DSM 44928]
    MATERAILAGGCFWGMEELLRREPGVVSTRVGYSGGDTPNATYRNHGDHAESIEIGYDPEVTDYRALLEFFFQIHDPTTR
    DRQGEDRGRSYRSAIFYLNDEQKRVAEDTIADVEASGLWPGKVVTEVTPAGDFWEAEPEHQDYLQRYPNGYTCHYPRPNW
    KLPRRAEA

    >gi|256395561|ref|YP_003117125.1| thioredoxin [Catenulispora acidiphila DSM 44928]
    MSVEPKTVRCPHCGKNNRVPAAAEGHPRCGNCHQSLPWIVDAEDSTFTQVVDKASIPVVVDLWATWCGPCRMVSPALEQV
    AADLAGKIKLAKVDVDASPQLSQRFEVRAVPTLLVIDRGRVLARQAGARPAAELRAWVEEALAGGSAAESSAATGSAGAP


    >gi|256395651|ref|YP_003117215.1| uncharacterized peroxidase-related enzyme [Catenulispora acidiphila DSM 44928]
    MAYIDLGLDEHEFPGITGLLAFRPETAKPFRDLLNILLHGPHSLSAGERELIAAYVSGLNECVFCCTSHSAFAAAQLDEG
    RPLVEQVLANLDSAPISSKLRALLRIAGAVQQSGRNVTERLVEDARAEGATDLEIHDTVLIAAAFCLANRYVDGLGTILG
    DDAHYTETTKRIVESGYTGRRVPSSR

    >gi|256396125|ref|YP_003117689.1| OsmC family protein [Catenulispora acidiphila DSM 44928]
    MSTSLKVTFPGGGGVALAARLELPDGAAPRAYAIFAHCFTCGKDAVAASRIARALTDHGIAVLRFDFTGLGQSDGDFGNT
    GFTSNVEDLVAAADHLRTEYGAPSLLIGHSLGGAAVLAARHGIPEVRAVVTIGAPADPSHIAHLLSEARDTIERDGEATV
    TLGGRDFCVRSSFLADIADQPQAERIHDLKAALLVMHSPQDETVGVDNARQIFDAARHPKSFVSLDGADHLLTRRRDAEY
    AATVLAAWVSRYLPEPEPSTVATLDTSVTVTETGTEPLQQLITAGRHHIVADEPVPTGGDTGPNPYDLLLAALGA
    CTSMT
    LRLYATRKNLPLEKVTVSLNHDRIHATDCEECETTTGFVDRIDRTIRLDGPLTREQRDRLLEIADKCPVHRTLTSETVIQ
    TRLAEGVTKAEQ

    >gi|256396204|ref|YP_003117768.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Catenulispora acidiphila DSM 44928]
    MASTPDLGVPAPDFTLPGIVLSGTEVERRDFTLSAHRGKPIVLAFYPGDDTPVCTKQMCAYNNELEKFADIGAEVWGISP
    QDLDSHEKFAQRHGLQQPLLADPAKTVIQQYGVGLKALGLKRSVFLVDAEGVLRWKHVATLGLKFQSVDTLTAQIAALA

    >gi|256396240|ref|YP_003117804.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Catenulispora acidiphila DSM 44928]
    MPGTTTRTFDVIVIGAGPVGENVADRTTAAGLDTVIVEAERVGGECSYWACDPSKALLRPVLLHSELRGTPGLESAANQT
    LDAAAVLRHRNTMASEWDDAGQVEWLNKAGISLIRGHGRLAGPKEVTVTTPEGDVLLLTARHAVAVCTGTTAALPPLPGL
    EELRPWTSREATSAKEVPARLAILGAGVVATEMATAWQALGSQVTLIAREPGLLPRVEQFAADLVTERLRESGVDIRFDS
    GIAGAVRSPDSGDVHITLVDGSEVVVDELLLATGRAPRTDDLGMETVGLRAGDWLAVDDLFTVEEVDGEWLYAVGDVNRR
    ALFTHQGKYQARIAGAVIAARAHRRPLDIRRWSRFVGTADRVAVPQVVFTDPEIAAVGLTTAEAERTGQVVDVVDYEIGQ
    VAGAALHTVGYRGHARLLIDPRRRTVVGATFAGAGVAELLHSATIAITGEMPVERLWHAVPAFPTISEVWLRLLETYRDA
    I

    >gi|256396439|ref|YP_003118003.1| DSBA oxidoreductase [Catenulispora acidiphila DSM 44928]
    MVLVCCMSSPTPEQAAPRAVADFWFDPLCPWAWMTSRWMLEVEKIRPVDVRWHVMSLSVLNEHREDLPQRYRDLMDSGWG
    PVRVVIAAQQQHGEEYVLPLYTALGTRHHPGGREFTREVIVEALEEAGLPASLADAADSDQYDEALRKSHAEGINLVGQD
    VGTPVVAVNGVAFFGPVVTPAPKGEDAGKLWDGCLLVASTPGFFELKRTRTQDPIFD

    >gi|256396455|ref|YP_003118019.1| OsmC family protein [Catenulispora acidiphila DSM 44928]
    MATTRKADTHWEGSLLDGKGNVTLASSKSGTFDVTWASRATDEAKETSPEELIAAAHATCYSMALSHGLAGAGTPPNSVD
    THAEVDFQPGEGITGIRLVVRADVPGLSAEDFQAAAENAKAN
    CPVSKALAAVPSITLDAALV

    >gi|256396493|ref|YP_003118057.1| methionine-R-sulfoxide reductase [Catenulispora acidiphila DSM 44928]
    MVEKVQKSEAEWRSLLSPMEFAVLREAGTERPWSGEYVSTHTEGTYHCRACDAPLFRSQAKYDSHCGWPSFYEPGEGDAV
    TLLEDRSHGMVRIEVRCAACGSHLGHVFDDGPREHGGQRY
    CINSVSLKLDEEPSAS

    >gi|256396633|ref|YP_003118197.1| UBA/THIF-type NAD/FAD binding protein [Catenulispora acidiphila DSM 44928]
    MLNPVRVADFVLDAIAARIGAVEPEQGGALLGLPGLDYISEFIHDADAATTTTRYQNTDWLIAAIGAREAASAARFKGIV
    HSHPRGMPVPSSQDQAEYAESLRLNPQLARYLAPIVTHDVDTPLAGHEVRLGPARISFFGAERAADGFALTPVRPVVVPL
    MRMLRRAGVRPEGDPAAIELEGTTLLATQAQLPGFGAVTLLLGADFPATAPIVLPEQSDGPLALRWDLGLPTIERLAGAV
    LALRRGRAREREGRDASHRDDAGAAAEVNPAAADGGGRGADKDEQSAEAFGGAGAFGGAENVSGTKGSASDEAARSAGTA
    EGDRGADEDEQSAGAFGGARSVAGAENVRGTKGSASGEIARSAGAAEGGRGSDGGANAGGVVGSEAGAGDAGGAPGGRRD
    PGAVLFARSEGILSPSLAGRSVLIVGAGSVGSYMAEVLARSGVGAFVIVDPDVVEAVNVGRSGFRVADVGLGKAWAAGEV
    VLAVNPRARVGVFGARHGDVDLAALVGGADVVVVATDDPEAQARVGHFAYWAGRPAVFPGLYQGARGGEVIIAAGGSACF
    A
    CATGGVRADLQETGSGEVAARTDYGTGRLIAEPGLLADVHQVAAVAAKVTLGLLHAPDDDAAAARFAYGILKAGTTYAV
    FGHEPDYWIFADLMRSAPAQYAYQSLWLSVASRSDCAVCGEPEGRTDPSAYQEPDIDLIRALKDSR

    >gi|256396651|ref|YP_003118215.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Catenulispora acidiphila DSM 44928]
    MPSSSLEGVRLNPGDTAPAFTLTDDHGAAVSLADFAGRKVILYAYPAAMTPGCTKQACDFRDNIASFQKEGFAILGLSPD
    KPEKLAKFRERDALTFPLLSDPDKAVLQEYGAFGEKKLYGKTVVGVIRSTFVLDVDAKGVAKVEVAQYAVKATGHVAKLR
    RDLGLDS

    >gi|256396858|ref|YP_003118422.1| methylated-DNA/protein-cysteinemethyltransferase [Catenulispora acidiphila DSM 44928]
    MSTLSYTTIPTPAGPFTVLADADDTVHAAGFTDDPAFLAGMLSAPVPEEGAHEPVAERVAAYFGGDLAALDDVAIAYRAT
    GPFRTAAWDAMRAVKAGDTISYTELAATAGNPAAVRAAGSACASNAIALFVP
    CHRIVRSDGSSKNFLYGLECKATLLAHE
    RQHAGV

    >gi|256396901|ref|YP_003118465.1| glutaredoxin [Catenulispora acidiphila DSM 44928]
    MDDQITMYSTSWCGYCRRLKSQLEREGIGFAEVNIEQVPEAADYVMSVNGGNQTVPTVVVVAPGGEKVAMTNPSLAQVKQ
    AAGI

    >gi|256396916|ref|YP_003118480.1| UBA/THIF-type NAD/FAD binding protein [Catenulispora acidiphila DSM 44928]
    MSNLPPLVEPAADLTVEEVRRYSRHLIIPDVGMAGQKRLKNAKVLCVGAGGLGSPTLLYLAAAGVGTLGIVEFDVVDESN
    LQRQVIHGQSDIGRSKAESARDSITEINPLVRVNLHEERLDSTNVMELFAQYDLIVDGTDNFATRYLVNDACVLLNKPYV
    WGSIYRFDGQASVFWSEYGPCYRCLYPEPPPPGMVPS
    CAEGGVLGVLCASIGSIQVNEAIKLLAGIGEPLVGRLMIYDAL
    EMTYRQVKVRKDPDCAVCGEHPTVTELIDYEAFCGAISEEAADAAKDSTITVTQLKEWLDTDEKIQLIDVREPNEYEIVN
    IPGATLIPKGEFLMGTALEKLDPTKRIVLH
    CKSGVRSAEALAVVHAAGYKDAVHVGGGVLAWVNQIEPEKPSY

    >gi|256397182|ref|YP_003118746.1| Redoxin domain protein [Catenulispora acidiphila DSM 44928]
    MAATTAAALTFGLAACGGSGPKNKDGLGKSAAFSVKDRKQFPMLSGTTLDGAKLDMASYKGKVMVVNIWGSWCDPCQQEA
    PYLEHANEAYRDKGVQFVGIDTRDNTGQAQAFVKAKQISYPNLVDDGNETLLSKLAGITSLASVPSTMIIDKNGDLAWRA
    LQPVSFTDLSTALDTVLSGQ

    >gi|256397218|ref|YP_003118782.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Catenulispora acidiphila DSM 44928]
    MSSPISTDQLNENANQNENHSENESQTYDVVIIGGGAAGLSAALMLGRARRRVLVVDARAPRNANAGHMHGYLSRDGMPP
    LELLEHGRDEVLSYGGVIVTDFAEKAERTAEGFHVTLASGCTATGRQLLVATGLTDVLPDIPGLAELWARDVHV
    CPYCDG
    WEVRDGALATVATGPFSTHHTLLLRQWSADLVYFLNGQPLDDADRAKLTARGVRVEEQPLRRLVTSEGRLSALELADGTR
    VERETVFLVPAFEANGTLLDALGCEKDPETGWVSTGIGGRTSVPGVWAAGNVADPTNGVIAAAGAATMTAAQINAALVEA
    DVAADVEAMRAAATTDVL

    >gi|256397346|ref|YP_003118910.1| Rhodanese domain protein [Catenulispora acidiphila DSM 44928]
    MSRNDVLVDADWVQAHLDDPKVVLVEVDEDTAAYDKNHIRNAVRIDWKRDLQDPVRRDFVNQEQFQALLSERGIANDDTV
    VLYGGNNNWFASYAYWYFKLYGHGDVKLLDGGRKKWELDSRELVVEQPTRAATSYTAQPQDQSIRAYRDDVVAAIGSTNL
    VDVRSPDEYSGKLLAPAHLPQEQSQRPGHVPTAANIPWSKAANDDGTFKSDDELTALYEGEGVDLSKDTIAY
    CRIGERSA
    HTWFVLHELLGQDNVKNYDGSWTEYGSLVGVPVSLGSNPGSPEGGQQ

    >gi|256397558|ref|YP_003119122.1| methionine-R-sulfoxide reductase [Catenulispora acidiphila DSM 44928]
    MVYKVERTEAEWRQHLGPAAYKTLREFGTENPWSGAYVENDDSGIYLCRGCDTALFGSQSKFNAECGWAAFASPLTDDLI
    EKYEDRSQGMLRTEIRCSTCGSHLGYLFQDAPEELGGWRY
    CVNSIGLFLRESVSSGASGSASGSVSSTAS

    >gi|256397780|ref|YP_003119344.1| OsmC family protein [Catenulispora acidiphila DSM 44928]
    MKPIYTAVATSVGREGRSFTDDGKLDLNMTFPQSMGGNGEGTNPEQLFAAGYSACFASAMQLVAKQQGVDVSEASVTAEV
    TLNSLDGGAFGLSVVLRAELPEELHGEKGKALLDATHLV
    CPYSNATRGNIPVEIVVE

    >gi|256397934|ref|YP_003119498.1| heavy metal translocating P-type ATPase [Catenulispora acidiphila DSM 44928]
    MAETLEAAAGSGARNDVELAIGGMTCASCASRIERKLNKLDGVTATVNYATEKAKVSFPADYAPADLVAVVEAAGYTAAL
    PEPPAPVGPASADGEPPKSAAELEDERRAVSLRQRLTTAVVLSVPVVLMAMIPALQFRNWQWASLTLSAPVVTYAAWPFH
    KAAWTNLRHRAATMDTLVSVGVSAAFLWSLWALFFGDAGMPGMKHGFDFAVSRTDGSGSIYLEAASGVTAFILAGRYFEH
    KAKRRSGAALRALMTLGAKDVAVLRGGAEVRIPIGELAVGDLFVVRPGEKVATDGVVEQGRSAVDASMLTGESVPVDVAP
    GAAVTGATVNTSGRLVVRATRVGADTQLSRMAKLVEEAQNGKAAAQRLADKISAVFVPTVILLSLATLAFWLLVGSQEAG
    VATAFAAAVSVLIIACPCALGLATPTALMVGTGRGAQLGILIKGPEALENTRRVDTIVLDKTGTVTTGSMALVGITVAEG
    ESEDEALRLAGALEQASEHPIAKAVAAAAAERTGALPAVEGFENVEGLGVQGVVDGHAVVVGREKLLAEWAQHLSPELAA
    AKAGAEAAGRTAIAVGWDGRARAVLAVADAVKPTSAEAVRELRALGLTPVLLTGDNETVARAVAAEVGIEEVLAEVLPLG
    KVEAVRRLQAEGRVVAMAGDGVNDAAALAQADLGLALGTGTDAAIEAGDLTLVGGDLRTAATAIRLSRRTLAIIKGNLFW
    AFGYNVAALPLAAAGLLNPMIAGAAMAFSSVFVVSNSLRLRRFH

    >gi|256398132|ref|YP_003119696.1| thioredoxin reductase [Catenulispora acidiphila DSM 44928]
    MSEIRNVIIIGSGPAGYTAAVYTARAGLNPLVFAGSVTAGGALMNTTDVENFPGFPEGIMGPDLMDNMQKQAERFGAELV
    FDDVTAVDLSGAIKKVTDSAGTVHEAHTVIVSTGSAYKELGLPDEKRLSGKGVSW
    CATCDGFFFKGQDIVVVGGGDTAME
    EALFLTRFGQTVTVVHRRDELRASKVMQERAFANPKISFVWDSEVAGIEGETHVTGVKLRNLKTGEETLRPAGALFVAIG
    HLPRTELFHGVLDLDDEGYIKVDSPTTRTSLPAVYACGDVVDHTYRQAITAAGTGCAAALDAERHLSELAHHQPVTV

    >gi|256398133|ref|YP_003119697.1| thioredoxin [Catenulispora acidiphila DSM 44928]
    MGDIRQVTDATFEEEVLKNDKPVLVDFWAPWCGPCRQVAPVLEAIYAEHGEKIDVVKLNTDENPLTQAKYGVRSIPTLNV
    YRGGEVVKTIVGAKPKALLLKDLADYVA

    >gi|256397961|ref|YP_003119525.1| alkylhydroperoxidase like protein, AhpD family [Catenulispora acidiphila DSM 44928]
    METRFDLSASPTASKLLKRFYSTSQVIEKSSLPKTLQDLVSLRVSQINGCGWCVDIHTKEAAAAGETPLRLNLVATWRHS
    TVFTESERAALALAEEGTRITAPGEVVSDATWAAARTQFDDDQLGTLICLIAMMNATNRISLIPNLLGGSYEPGMFAALE
    N

    >gi|256394841|ref|YP_003116405.1| Protein-disulfide isomerase-like protein [Catenulispora acidiphila DSM 44928]
    MSQANRVGKQNARERVLAEKIARQRAERRRKQLTIGGVVVLVVAVAGGVGIAVSAAKHNSTPYAAPAAAVIDPQAKSSKA
    TGIHIGSNDAPVKMNVFEDFR
    CPVCQEVETAVEPTYRQYVEAGKLQITYHPARVIDSHDNGSGSLNGANAAACAQDQGDF
    LQLHDLLYANQPNEQTDPWADRSAVLKIADEIPALKSSPGFQSCVTGGTHNGWVQSNADNFNKLGLPGTPTVFIDGQQLS
    FTQTSADAVLQYFQGQLDAAFKKDGGKAGTPTTLPTAPTSAPSSGASSSGASSSAGAPSSSGAPSSSGSPSGTPTGTSSS
    TGSTPTSSKS

    >gi|256394842|ref|YP_003116406.1| integral membrane protein [Catenulispora acidiphila DSM 44928]
    MTTSGGSGPKRSGRERAAEARRRQAAADRRRKQLVIGGVVVAVIALAVLIGVLVQHNTSNSNKNARDAYGAGQPFAAPSG
    VTPSPGSAADPGAIVYGKPDAKVTVEVDEDVR
    CPFCKQAESFFGATNKEYADAGKIQVHYRLVDLIDRNGGGQGSLVGGA
    TLACAADVGQAEFIAFHDLIFKNQPAETDDAYGSVDTMLNLASQVPNLRSATFDACARDGKYAQWIKDNYTWLSKKLGGS
    VGTPDIYIDGTSFPLKDPTVVPGTQQTADYRAALDAAVAKQG

    >gi|256397991|ref|YP_003119555.1| alkylhydroperoxidase like protein, AhpD family [Catenulispora acidiphila DSM 44928]
    MTTNTEVIEYVKPTVRLAVDDLVPAMAKAMNGLERAAGETSLEKPLREMVKLRASQINGCVYCVDMHSRDAVAGGDTWRR
    LNLVAVWREAPYFTARERAALALTEAVTRLADREVSDEVWNEAAAHFSETELAELVWHIGLINLWNRLGATARPWDLSGG
    AQD