Carboxydothermus hydrogenoformans Z 2901 uid57821

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|78044623|ref|YP_358901.1| putative inner membrane protein [Carboxydothermus hydrogenoformans Z-2901]
    MGEIIKSYYQKVIAEFWDQKTAVVLLGILSGLYFGTVGVVWAVTGEFTRWGASFLKLIGVDLSPYTYLKIIKYKGTVLTR
    IDGVMVLGMFAGALIAALFGQNFKLRIPTAKRVLQALIGGIIAGFGTRLAMG
    CNLAALFTGIPQFSLHTWFFTLGTIFGT
    YIGIKITLSPYFRGEPKLVKASEFNAGNLKANTQIQPFLGWLGLIVFAGILLSRPEMPNNLKLATVFGFAFGFLIQKGQV
    CFTSAFRDLWLVGRTTTLKALVWGMAVQMLLTAAFIAKGTPAKVLWAGPNALIGGLLFGIGIVIAGGCETGWMYRSMEGQ
    VHFWFVGLGNVIGATILFLVWDKGVYKYLAEPFPKFSLIEHFGYLPAFILTGLFLLGLYLWADLREASGRSMIKNKTMSV
    RRV

    >gi|78042898|ref|YP_359411.1| thioredoxin [Carboxydothermus hydrogenoformans Z-2901]
    MVLKFTDANFEDEVINSDMPVLVDFWAEWCGPCRMIAPIIERLAIDYLGQVKVGKLNVDENRETAIALGIMSIPTVMIFK
    DGKVLDTIIGYQPENVFREKIEKALKK

    >gi|78044795|ref|YP_359413.1| UbiE/COQ5 family methlytransferase [Carboxydothermus hydrogenoformans Z-2901]
    MLEKIIARYEKESGEGLSCGNNIAVGSLKPGMIVLDLGCGNGGETIRAAQIVAPGFAVGLDITEKLLEKGQKKAREQGVK
    NVVFIKGEIENLPFVGESFDVVISNCALNHARDKLKVYREIYRVLKEDGYFIVSDPVSLVELPPEIKNNEELWAQ
    CFAGA
    EEESKYLRYIIEAGFTLEILKRREYEKNGYPFASLTIKGTKKRR

    >gi|78043252|ref|YP_359418.1| thioredoxin/thioredoxin-disulfide reductase [Carboxydothermus hydrogenoformans Z-2901]
    MSDKVIYLSQEQFDEVVLKSDVPVIVDFYSEDCPPCEALAPAYEKLAQQYGDKFKFVKIYRQQNRPLAEKLGVKGSPTVL
    FYVNGQEVGQRLTGYISKRQLREAMEKAFGQKLLPEVPETVKYDVIVLGGGPAGLSAALYTARAKLRTIVVDESVPGGQA
    ATTYHIANYPGTPGTIRGKELTQNMLNQALAFGAEVDDLKEVLKVELTGEVKRVITEDKIYEAPAIILATGAEPRKLPAE
    GEDLFRGRGVHY
    CATCDGAMYQGMKVVVVGGGNSAVEEAVFLTRFATEVTIIHQFDHFQASKVAQEEAFANPKIKVIWDS
    EVRKVVGDKHVTGVVIENLKTKELSTVPTDGVFVYIGTQPKTNLFAGQVEMNEWGYIITDEEMRTNIPGVFAAGDLRQKS
    VRQAVTAAADGVIAAVNVERYLASKK

    >gi|78045059|ref|YP_359423.1| putative mercuric transport protein, selenocysteine-containing [Carboxydothermus hydrogenoformans Z-2901]
    MRERISSILSVITAVLGCITCVGPVILASLGLGGASFSFFAPLAPYRSFFLVLTFVFLGYAFYETYFKGKSSKLNKIVLW
    SATVLVVIVLTYTYRYTLLSLFSF

    >gi|78044130|ref|YP_359424.1| rhodanese-like domain-containing protein [Carboxydothermus hydrogenoformans Z-2901]
    MPRSKYVFWVIIVLLLFALTGCLKAGYKDLEPDEAKKLIDENPMLLIMDVREPYEYAEARIPGSHNIPMGEVEQQLPNID
    KEQEILVV
    CETGSRSASIAQMLVSKGYKHVYNLKGGIANWPYELEK

    >gi|78043783|ref|YP_359425.1| glutaredoxin [Carboxydothermus hydrogenoformans Z-2901]
    MAKIELFSTPTCPYCRLVRNFLQEKGLNFTDYDITKDLDAFERMFKTTGYTTVPTLIINDKEVIIGLDEERILKAVNES

    >gi|78043684|ref|YP_359482.1| hypothetical protein CHY_0626 [Carboxydothermus hydrogenoformans Z-2901]
    MQTEKRAYYLSVIPGYLLLIGLGIALSIINPAMLLYYFLGMGIGFAMQKSRICVASAFNDLFLFKNPVGMKNLFFLILFT
    TVVFSSLQFFLPTHFGKGSIYYTGPFNLLGGILFGFGMVWAGGCAGSTLVRMGEGQLAAFLTFIFMFFGTFLGTYLFNFI
    WEMVISFKPVYLPETLGWLNAILLQLFLIVLIILVFYFWEKKQEDLAEVELEWEDTPFWKRPWPYLVGALFFVVFSGLIF
    YFSEKVWRVNTVFSFWGLWLLKSLGINIENWKFLALSSHRQIYENGFGALVFNFVNFGVIAGGFLASSISGEFRIRKIRK
    PIQFWGSILGGFLMGIGARLSFG
    CSIGAFIGGIASFSLHGWLFFAGLLVGAFLGTRGLKYYYLKAGKN

    >gi|78044229|ref|YP_359567.1| alpha keto acid dehydrogenase complex, E3 component, lipoamide dehydrogenase [Carboxydothermus hydrogenoformans Z-2901]
    MYDVAILGGGPGGYVAAIRAAQLGLSVVVVEKDELGGTCLNRGCIPTKALVSTAERLHQIKNSAAFGIEVTGYNFNFQKA
    AERKNQVVERLVKGIHYLFKKSKITLIKGTGKLTGKNEITVETSDGLEKVEAKNIILATGSKPALISALGYDGERVITSD
    EALNLEKLPAEMVIIGGGVIGSEFATIFSEMGVKVTIVELLPSILANTDKEVSRYLTTLFKKRGIQVKTKVAVKEVKKGE
    KVTVVLENGEELVTDMVLISIGRVLNTKDIGLEEVGVALGPKGEVLVDEYLRTNVENIYAIGDITSKMQLAHVASAQGIR
    VVENLVGEPQPMSYDVVPGCIFTLPEIAMVGLTSQEAEEKGIKIITGKFPFQASGKAVAMEETEGFVKIIADFYTHRILG
    GHIVGPHATDLIGEIALAVQKGLTLEEVAHTIHAHPSLPEAVMEAAEAALNRAIHI

    >gi|78044500|ref|YP_359586.1| Fe-hydrogenase, beta subunit [Carboxydothermus hydrogenoformans Z-2901]
    MRKVLICAGTGCISSGSPKVTEKFREELSKRGITDIEVYNTGCHGFCEQGPIVIIEPDKTFYCRVEVDDVPEIIEKHLLG
    GQIVEKVLFHEPQVDKKVEKYTDISFYAKQKRLVLHNCGHINPERIEDYVANGGYEALRKVLTSMSPQEVVDEIKKSGLR
    GRGGGGFPTGLKWQFTRDAKGDKKYVVCNADEGDPGAFMDRSVLEGDPHAVLEGMAICGYAVGADEGYIYVRAEYPLAIK
    RLQIAIKQAEEKGYLGENIFGSGFNFRIKIKAGAGAFVCGEETALLTSIEGNRGMPRPRPPFPAVKGLWGKPTNINNVET
    FANVPLIIKNGADWYASMGTEGSKGTKIFALTGKVNNTGLVEVPMGITMRQIIFDIGGGIKGGRKFKAVQIGGPSGGCLP
    EELLDLPVDYDSLIKAGAMMGSGGLVVMDETTCMVDVAKFFLRFTQKESCGKCVPCREGTKRMLEILEKITEGKGEPGDL
    ETLEKLAYNIKNSSL
    CGLGQTAPNPVLSTLRYFRHEYEAHIYDKKCPAGVCAALLEYKILEDKCVGCGACARVCPVGAIS
    GERKQPHQIDPEKCIKCGSCMEKCKFGAIVKG

    >gi|78044647|ref|YP_359587.1| NAD-dependent formate dehydrogenase, alpha subunit, selenocysteine-containing [Carboxydothermus hydrogenoformans Z-2901]
    MADVTLKINGIEVTVPEGTTILEAAQIAGFKIPTLCYDPELSKPGACRICVVEVKGARNLVASCVTPVAPGMEVLTHSEP
    VINARREILDLLLSNHPED
    CLTCDKMGECALADYAYEYGVRRGSYQGEKNVYPIEDNNPFIVRDMNKCILCGKCVRVCDE
    IVGYSVIDFINRGFKTKVAPPYDGTLAESNCVFCGSCVTVCPTGALTVKDTRGKFRPWEVKRVKTTCPYCGVGCNFDLLV
    KDDKVVGVAPNPTSEVNGRFMCVKGRFGYKFIHSDDRLTKPLIKKNGELTEASWDEALTLVAEKLGEIKAKYGSDSIGVL
    ASAKCTNEENYLLSKFTRAVLGTNNIDHCARL
    CHSPSVAGLAAAFGSGAMTNSFEDIMETELIMLIGSNTTESHPVAGYK
    IKQAVKKGAKLIVIDPRNIELASYADLHLQLKPGTNLPLLNAMAHVIIEEGLYNEQFIRERTEGFDSYKDTVKDYSPEAV
    AEICGVPAEKIREAARMYAKAGKAMILYTMGVTQFSFGTYGVLAVANLAMLTGHVGKDGAGVNPLRGQNNVQGACDMGGL
    PNVFTGYQRVDDPAANEKFSKAWGVKLPEKPGLTLGEMFDGALKGNIKAMYIMGENPVLSDPDARHIEEALKKLDFLVVQ
    DIFLTETAKFADVVLPAATFAEKDGTFTNTERRVQRVRKAIPCVGEAKPDWEIIALVATKMGYPMSYSSAEEIFDEMRTL
    TPSYAGITYERLEKKSLQWPCPAPDHPGTKFLHSDKFVRGKGLFHPIPFKEPEEKPDSEYPFTLITGRRLYHYHTGTMSR
    RSMMGEHVPEDHLEMNPADAKKLNIKDGDRVRVTTRRGSVEIKVALTDKVPEGTVFASFHFFESPVNQVTNPARDPMAKT
    PELKYSAAKIEKL

    >gi|78043443|ref|YP_359591.1| nitrite reductase [Carboxydothermus hydrogenoformans Z-2901]
    MKYLIIGNSAAGIFAAESLRKLDPAGEITVLTDEPYEVYGRCLTSYFIAGDIVEEQIFIRPKDFYEKNRINLKKGEKVVR
    IDFNEKKVITFKNSYQYDRLLIASGARAKKLSLPGSNLPGVFTLRTLDDAKNILDYSRKAEQAVIVGGGLVSLKGAYGLL
    KRGVKVTVVVASRQILSQVLDYEAAGLVQQNLEKQGMKFLLGEDVLEFLGEDKIFEVKLTNGQVIKADLVLIGKGVTPNV
    DFLPEPEKFLEGIPVDQYLRTPWEGVWAAGDVAKTFDVAHGKYRVNALWPIAAEQGRVAAMNMVGQNYVYQGSIGMNSLE
    FFGYNTIAAGITRQEEGYTVIKRRQGANYLKLVLEGEKLKGYILSGEVRGAGKLTQLIRSGSKIKQFPSFLKIF

    >gi|78044268|ref|YP_359594.1| dehydrogenase, selenocysteine-containing [Carboxydothermus hydrogenoformans Z-2901]
    MAFLQEKDIQFLKEKFAKEMVNDVTIHFFTKSPVLAQDCPYCDHTKQLLEELAATSEKIKLMVHTYPTEKEAVEKYGIDK
    IPAIVFEGTEDVGIRFYGIPSGYEFSTVIETIIDLSKGKPELPDNVLAELAKVTSPVTIKVFVTPT
    CPYCPRAAVAANRF
    AMANANIRAEVIEVSEFPELGDKYNVFGVPKSVINETVEIEGAAPETMFVQKVLEAVQ

    >gi|78043483|ref|YP_359663.1| methylated-DNA-protein-cysteine methyltransferase, selenocysteine-containing [Carboxydothermus hydrogenoformans Z-2901]
    MECDIITTDYGYVAIAVSEKGVYAVSLPKATPKAALEEIGVEVNPVKSELFCRTAELLKRYYAGEKVDFSSLPLDISWAS
    PFARKVYEKLRKIPYGATVSYGELAGLSGNPKAARAVGRAMATNKIPVIIP
    CHRVLAAGGGLGGFAGGLSLKEKMLKMEK
    QAL

    >gi|78042805|ref|YP_359705.1| hypothetical protein CHY_0854 [Carboxydothermus hydrogenoformans Z-2901]
    MEDRVMPIAEENLPEELKPIYENFKQNFGEVPLPIKVMANNPAYLKLFVQKHKVLWEENSLDPKTKVLIALVISTLNNCE
    F
    CIRNYTMQAKKLGISDKEIIEAISLIDLVGSMNHFNNGMRIKP

    >gi|78044655|ref|YP_359711.1| cation transporter E1-E2 family ATPase [Carboxydothermus hydrogenoformans Z-2901]
    MAKNSIFYLTGCSCQSCAAVLEERVKKLPGVIDAELDFAAGKLKVLGDVDPEVIIKEAEKEKFKAYLSRSDVPKAQNFFK
    ENYLLLMGILFLLVGTGINFIGQDKVASLFYLAAILAGGRETIEKGLKNLWQRKITSDLLMLTGLIGAMALGELTEAALA
    AVLFGISEFVENYNLEKARTALKELFAAVPEEALVLKNGEEQLCKVEEIRPGDLVVIKPGEKIPVDGVLKKGRIEVSQAA
    ITGESRGILKLPGEEVYAGSINLDGFGIIETQKPSGETVIARMAELIEEAQKEKLPAQTLLDRFAAVYTPLVLALAFLVA
    FIPPLLLGGEFRLWIYRALTFLVVSCPCALLIAVPISVISSLGAAARRGIVVKGSRNLEQLALCDTIVFDKTGTLTRGEM
    EVTEVIAVSPDFWPAVYSLEKRATHPLAKAIIKAVPAEYQKEIEVLNFRQIPGLGVLGQVEGSNYFIGSPKGIKEIPESF
    IKTLQEIEEKGQTAILVAKENIPVALLAVADVIRDDAGEAIRNIKALGLTPVLLSGDSKKVALRVSEELEIGKWYGEVLP
    QEKLTVIKELQESGRKVIMVGDGINDAPALAAADAGIAMGEGSGLATTTAKIVLLSGKLNNIPFLIKLARQSRAIVKQNI
    ILAIGLKLLALMAILPGWLNLWLAIGADIGVALLVSLNGLRVLWLK

    >gi|78042876|ref|YP_359755.1| thioredoxin-disulfide reductase [Carboxydothermus hydrogenoformans Z-2901]
    METRELVIIGGGPAGLAAAIYGARAALNPLVLERGVPGGQAATTEWIENYPGFEDGIGGFELMVHMQRQAEKFGAEFKNA
    DVTGIKKENGVFILNTSTGEIAAKTVIIATGAEPKELGVPGEREFRGRGVSY
    CATCDGNFFRGKTVAVVGGGDSALEEAI
    YLTKLVEKVYLIHRRDGFRAAKVIQERAKANPKIEFVLNTVVEEIAGERKVEKVIVKNVQTGEKSEILVDGVFIYVGLKP
    NTAFLEGFLELENGYIKTDENMATAIPGLFAAGDVRLKDLRQVVTAVADGAQAAVAAEKYLEGNK

    >gi|78044755|ref|YP_359777.1| heterodisulfide reductase, subunit A, selenocysteine-containing [Carboxydothermus hydrogenoformans Z-2901]
    MKRIGVFVCWCGSNIGGVVDVPRVAEAAKEMPNVVFATDYKYMCSEPGQELIIKAAKEHNLDRVVVASCSPRLHEQTFRK
    AAERAGLNPYMFEMANIREHVSWVHAQEKEKATEKAIELVRRAVFKAARLEPLYKSAIGITKKALVIGGGIAGIQAALDI
    ADAGYQVILVEKEPTIGGKMAQLDKTFPTLDCSS
    CISTPKMAAAAQHPNIKLYTYAEVTEVSGYIGNFEVTIKQKAKSVD
    HNKCTGCGTCWEKCPTKVDSEFDLGLGKRKAIYIPFAQAVPNKPVIDRTTCRQFTKGKCGVCQKVCPTGAVDYDQQDEYI
    KEKVGAIIMATGYDLFEWEKVYGEYGYGQYPDVITGLHFERMASASGPTGGKIIRPSDGKEPKTVVFIKCVGSRDDQKGK
    SYCSRACCMYTAKHAHQVLEKIPGAQVYIFYMDVRTAGKMYEEFYAKTLEDGAQYIRGRVSKIYPLGDKLIVRGADTLAG
    VPVEIEADLVVLATAMVPAKGSEEIAKIVGFSLDKDGFFQEAHPKLGPVETTTGGVFLAGACQGPKDIPDTVAQASAAAA
    KVIGLLSKDQLAAEPIVSQVNEALCSGCELCKPICPYKAIDMKKITERVHGKVIERTVATVNTSLCQGCGACTVACRVGA
    LNLKGFTNEQLLAEVEAICL

    >gi|78042694|ref|YP_359786.1| heavy metal-binding domain-containing protein [Carboxydothermus hydrogenoformans Z-2901]
    MCEHCGAHNHAAEQTVVLKVDGMTCNHCKMSVEKALYTVNGVKMAAVNLAEGLATVLYDPNLATVEQMKAAVEKAGYEVV
    GVQ

    >gi|78044857|ref|YP_359787.1| copper-translocating P-type ATPase [Carboxydothermus hydrogenoformans Z-2901]
    MVIAMETVNLKVYGMSCAACVKKVEKGISGVPGVEQVVVNLINNQVAVKYDPQKTGISDFARVIEDLGYEMGVAEYKFRV
    EGMS
    CAACVQKVEKAARGFAGVLDAVVNLPAQQLTVKAYEGVLDVGRLKREIRELGYEIFNFEEIDPLAREKEAREKEIR
    HQRLKMIVVWPLAILAMIGTMRHLWIFKYFVPEFLGNNYFLMAITTPVVLYGGYEFFVKSYQGLKRGVTDMNLLYATGIG
    SAYLIAVINTLFPNAGFGGPKATFFESAALLTAFIILGRYLEALTRGRTSEALRKLISLKPKTARVLINGEEKEIPADEV
    EIGDLVVVRPGETIPVDGVVERGTASVDESMLTGESLPVDKGEGSMVLGGSIIKTGALTVKATRVGKETSLSRIIKLMEE
    AQTTKAPLQKLADVVAGNFILGVHILALVTFFFWFFYGYQAYFTPETRFLMSPAKIAEMGVFGFSMLISLTVLVISCPCA
    VGLAMPSAIMAGTGKGAEYGVLFKNAEVIEKMTKVKVIAFDKTGTITKGEPEVTDLIPFEINEQQLLELAGVAEKLSEHP
    LAQAIIKKYREINQKEPSEPATFHNIPGKGIMATYSGVNILAGSEKFLQENRVDTSLAGEIAKKLKGEGKTLVYFAADHR
    LVGVIALADTVKESSAKAIELLKKKGYIPVMLTGDNEVTARAIAQKVGISEVVAGVLPEGKVEAIKAYQEKGYMVAMAGD
    GINDAPALTQADVGIAMGTGTDIAKEAGEVVIVKGDLVDIVNAMDIARATFGKVKQNFFWAFVYNTLGIPFAAGVFYPWT
    KALVSPELAALLMAFSSVSVTLNTLLLKRFKPSGKAVG

    >gi|78044353|ref|YP_359941.1| thioredoxin domain-containing protein [Carboxydothermus hydrogenoformans Z-2901]
    MEKKSTIALIVVFVIALLAFGVYYATNRELGSPANSGNVIDQYNEALKNHEPFLLEFSGATCPTCAQMAPVVQELKKEYE
    GRMRVIVAEVSRQDSQQLAAKFGIQYVPTFIVVDQNGNIVPWTDAQGNQMPMFVGGLTKEELKAQMDKVALKEKKTPELN
    DSGKKKSFAQTLADKLPGLLGDSKLLALFVVFLGGIATSFTPCILGMIPLIIGYTGGYAGRSPAKGFIYSLFFVLGLATT
    LTLLGVGIGVLGTFIKSRLFAFNFILGIVAILMGFAVMGFYTINLPGLKRMPVKGTGLFSSYLMGLFFGLSASPCATPVL
    IVIVTYALAKASPLFGGALLFSYSFGHGLPLILAGTFSAFLGKITSLGRYGEIINYIFGGILVLYGLYLLFGRLL

    >gi|78044565|ref|YP_359942.1| redox-active disulfide protein 2 [Carboxydothermus hydrogenoformans Z-2901]
    MDIKVLGMGCANCEKLERMVFNALAELNIDANVQKVQDIPEIMKYGVMSTPGLVINEKVVLSGRVPSKAELEKIILEHAN
    Q

    >gi|78043330|ref|YP_360543.1| hypothetical protein CHY_1723 [Carboxydothermus hydrogenoformans Z-2901]
    MRQPNRLIHEKSPYLLQHAYNPVDWYPWGIDAFKKALMEDKPVFLSIGYSTCHWCHVMERESFEDEEVADLLNKHFVAIK
    VDREERPDVDQIYMTACQAMTGQGGWPLTIIMTPEKKPFFAGTYFPKRSKWGRPGLMEILTEIVKLWETDREQLLTISKR
    LYEFMQTIPQSKKGDLTEEVLEKAYREFLGRFDSEYGGFGPAPKFPTPHNLIFLLRYWKRTGEEKALFMAEKTLEAMARG
    GIYDHVGYGFHRYSTDREWLVPHFEKMLYDNALLAYTYLEAYQATKKEKYARIAREVFTYVKRKMTSPERGFYSAEDADS
    EGVEGKYYVWTPDEVKKVLGPEEGELFCRVYDITPEGNFEGKNIPNLIHTDIELVAQEIGKSAAELTESLDRMRQKLYHE
    REKRVLPLKDDKILTSWNGLMIAALAKGARVLQDQELLNMAHNAAEFIFSKLRRADGRLIARYREGEAAVLAYLDDYAFL
    IWGLIELYEASFEVWYLKLAVELTREMLKLFWDEKHGGLFFTGADGEELITRPKEIYDGALPSGNSVAALNLLRLSRMLG
    EEDFLQKAVEILSTFAGKVSEIPSAHSFYLLAYLFYLGPVKEIVVAGEPDGEDTRAMIEKINLAYLPNSVVLFHPIGDAG
    QEIREIIPHIADKKSLIGERATVYVCENFSCKAPVVEVEMLEEYLM

    >gi|78043167|ref|YP_360674.1| molybdopterin oxidoreductase, iron-sulfur binding subunit [Carboxydothermus hydrogenoformans Z-2901]
    MSSDKKWAMVIDLQKCIGCDTCTVACKAENRTPPGISYNVVIEEEKGIFPNVTKIHIPRPCMQCDRPACVQVCPVKATYK
    MENGIVAIDYDRCIGCRYCVVSCPYGARSFDFGEDYSREMIGYNEVQAPEYGIYRGKREKGKSPIGNVRKCMFCYHRLQR
    GEEPACVEVCLGDARYFGDLNDPESVVSKLAASPRAFVLQEEMGTKPRVIYLK

    >gi|78043225|ref|YP_360810.1| putative oxidoreductase [Carboxydothermus hydrogenoformans Z-2901]
    MAFDRPTKKYPMPEQDPKVRAKNFDEVALGYSLELAMKEAERCLDCKKPACKQGCPVEVDIPDFIRFIKAGDIDSAINKI
    KEKNALPAICGRVCPQESQCEGQCVLGKKGEPVAIGRLERFAADYELAKGTQNVTVAPPTGKKVAVIGSGPAGLT
    CAADL
    AKLGHKVTIFEALHVPGGVLMYGIPEFRLPKRIVQQEIDNLKKLGVEIKTNTVIGKSLTVDELLDEEGYDAVFVGTGAGL
    PNFMGIPGENLNGVYSANEFLTRTNLMKAYLFPEYDTPIKVGEKVAVLGAGNVAMDAARTALRLGAKEVYIVYRRSRNEM
    PARLEEIHHAEEEGVKFMLLTNPTRIIGDENGWVKAMECLKYELGEPDESGRRSPVPIPGSEFIIEVDTVVVAIGQSPNP
    LVPRTTKGLEVGRKGNIIADENGKTTREGVWAGGDIVTGAATVIKAMGAGKKAARAIHEYLMSK

    >gi|78044963|ref|YP_360877.1| selenide, water dikinase, selenocysteine-containing [Carboxydothermus hydrogenoformans Z-2901]
    MEAVKLTQLVSCAGCAAKMSPETLAQVLRYLPEINDPNALVGTNTADDAAVYRISDEQAIVLTVDYFTPVVDDPYYFGVI
    AAANSLSDIYAMGAKPLFALNVVGFPKKLPPEILATILKGGADKAREAGIPVLGGHTVDDAEPKYGMVVCGLVHPDKIVK
    NHPPHPGDSLILTKPLGIGVLTTGMKRGIVPENTAKKVMEVMETLNDKAAEVMVEVGVSAATDITGFGLLGHLKEMLQEE
    FGAEIYLTKIPAIEGAWEFAGMRVFPGGAKNNLNYLLPHLDFAGEFAEEEKLFLADPQTSGGLLMAVSQEKKEELVKKLQ
    QKGVLAAEIGIITGNKGKIVVKR

    >gi|78043796|ref|YP_361015.1| thioredoxin [Carboxydothermus hydrogenoformans Z-2901]
    MGIITLTDENFETEALKREGLIIVDFWAEWCGPCRMIAPILEEIAQEYEGKLTVGKLDVDSNPETPRRYGIMSIPTLLFI
    KNGEEVGRTVGFKHKNELMKIIIKNL

    >gi|78044856|ref|YP_361186.1| thioredoxin-disulfide reductase [Carboxydothermus hydrogenoformans Z-2901]
    MERYDVIIIGAGPAGLSAALYSARSKLSTLYIEKLSTGGQAATTDEIENYPGFAHGISGPELTAQMEEQAKRFGAKKLLA
    EVKGIELAGADRIVKTTKGNFVAKVVIIASGAAPKLLGCPGEQEFRSRGVSY
    CATCDAAFYEGANVMVVGGGDSAVEEAC
    YLTKFADKVTLVHRRDTLRATKVLQERAFANEKLEILWNTVVEEIIGTDVVEKVRLKNVVTGEVFEREIDGIFIYVGLKP
    NTEFVKGLVNLDEQGYIITDENMRTNIPGIYAAGDVRQKLLRQVVTAAADGAIAAYHAEKYLEECTE

    >gi|78043049|ref|YP_361187.1| putative thioredoxin [Carboxydothermus hydrogenoformans Z-2901]
    MAGNIIELNKDNFEEEVLKSELPVLVDFWGPRCVPCMGLMPVVEELAEIYAGKMKFTKLNTAENRRLAIQLKVMSLPTFQ
    FYKNGELVDQLQGNFGREEIEEKIRAIIG

    >gi|78044558|ref|YP_361189.1| glycine/sarcosine/betaine reductase complex protein A [Carboxydothermus hydrogenoformans Z-2901]
    MAILAGKKVIAVGDRDGVPGPAIAECAKSAGAEVVFATTECFVCTAAGTMDLQNQARIKELAEELGGENIVVLLGAAEPD
    TASLAAETVTLGDPTFAGPLAGVSLGLKVYHILEPEIKAEIDPAVYEEQAAMMEMVLDVDALAAEVSKMRKEGSKY

    >gi|78044722|ref|YP_361190.1| glycine reductase, selenoprotein B [Carboxydothermus hydrogenoformans Z-2901]
    MAKFRVVHYLNQFFGQIGGEEKADTAPLKKDGPVGPGTALNGAFKGEAEVVGTVICGDSYFAENMEEALKQILSMIKEYN
    PDLVVAGPAFNAGRYGTACGAVAEAVVKNLGIPAVTGMYPENPGVEMYKKSVYIIATADSAIGMRNAIPKMAALGLKLLK
    KEEIGTPEQEGYIARGIRKNYFAEERGAKRAVDMLIAKIKGENFTTELPMPAFDRVPPNPAIKDLSKATIALVTSGGIVP
    KGNPDRIESSSASKFGKYSIAGVKDLTSDTFETAHGGYDPVYANQDADRVLPVDVLREMEAEGKIGKLHDYYYATVGNGT
    SVANAAKFGQAIAADLKASGVDAVILTST
    CGTCTRCGAAMVKEIERAGIPVVHMCTIVPISKTVGANRIVPTVAIPHPLG
    NPALPADEEKALRRKLVEKALKALTTEVEGQTVFD

    >gi|78044877|ref|YP_361369.1| hypothetical protein CHY_2576 [Carboxydothermus hydrogenoformans Z-2901]
    MKKVDLGWSEIKGGIVLGILNILLLLTWGKPWVVTHILTDWGTWWLKVLGMHPEKWAYYQEVYPEAFFKTTLFSQENLLV
    VGTILGGLFAALWHNEFRPKKIKSPGKFFLGIFGGILMGFGARLALG
    CNIGNLVGGIASFSLHGWIFGGSLIIGTYLGIL
    FLKKYIL

    >gi|78043810|ref|YP_361371.1| hypothetical protein CHY_2578 [Carboxydothermus hydrogenoformans Z-2901]
    MQRKVAYGLLFFFLIVPLYFLANQNFTRAAVFALGIGFGYAVSRSRFCFASAFRDLIMFRDKAMSRGVTVLIAVSAAGFF
    VVQFLAVLQGNVPPGKINPVGWHLVIGGIIFGAGMVLAGG
    CVISTLVRVGEGFFHYWGVLLGIVIGSVLGAFGYGYWKDI
    LISSQKFWLPGIIGWFPTLIIYAIIFFLLLKALREEM

    >gi|78043019|ref|YP_361472.1| thiF family protein [Carboxydothermus hydrogenoformans Z-2901]
    MLSREQLFRYSRNILLPEVGVKGQEKLLNSKVLVIGAGGLGAPVALYLAAAGIGTIGIADYDVVDLTNLQRQIIHFTRDV
    GTEKVLSAKSKIEALNPEVQVITYNEPITSANILSIIEQYDFIIDXTDNFPAKFLINDACVKAKKPFSHGGILRFWGQTL
    TYRPDGETPCYRCAFKEPPPPGSVPS
    CKEAGVIGAVAGVIGSLQVTECIKYLLGMDTLAGNLLFVDLKLMEFNKIPLKKR
    QSCLCSKDPEEIILVDYSQPVCDLKGEN