Capnocytophaga ochracea DSM 7271 uid59197

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|256818885|ref|YP_003140164.1| NADH:ubiquinone oxidoreductase, subunit E [Capnocytophaga ochracea DSM 7271]
    MLEYLTLIFKSVFVENMIFATFLGMCSYLAVSKKVSTAIGLGAAVIFVQTLTVPMNYLLNQYILKEGALAWLGPEYANYD
    LSFLTYILFIATVATMVQLVEIIVEKFSPSLYNSLGIFLPLIAVN
    CAILGGSLFMQSREETIHSFGLSVAYGFSSGLGWA
    IAILALAAIREKIRYSHVPAPLRGLGITFITTGLMAIGFMSFGGMLTGGSSKKEAKEAPKQETTIQQEVKTDKLAHNTKD
    LSNDISK

    >gi|256818886|ref|YP_003140165.1| NADH:ubiquinone oxidoreductase, subunit D [Capnocytophaga ochracea DSM 7271]
    MGLSKKDTKLVTDPLWDNNPVTVQVLGICSALAITAQLKAAIVMSLSFTFVLVMGNVTISLLRNVIPPKIRIIAQLIVAA
    ALVIVVDFVLKAYVYDLSKQLSVYVGLIITN
    CILMGRFEAFALGNPPGKSFLDAIGNAGGYSIALLIVAFFRELLGSGTL
    LGFQVLGDPIKKTGVYAWGYENNGFMLLAPMALVTYGIVVWVQRSRNKALIEDSH

    >gi|256818912|ref|YP_003140191.1| methylated-DNA/protein-cysteinemethyltransferase [Capnocytophaga ochracea DSM 7271]
    MKKNKMVKLYKKRINTPIGEMLAIATDEAICMLDFVDSKNWLKDQEILVKHYGATQVDEDSLLLSELEKQLREYFAKERK
    EFSLPLALVGTSFQEEVWKVLQTIPYGEVRSYKEQATAVGNPKGVRAVANANGKNRISIVIP
    CHRVIGSDGTLTGYASGI
    ERKQFLLDLERSNV

    >gi|256818954|ref|YP_003140233.1| Redoxin domain protein [Capnocytophaga ochracea DSM 7271]
    MMMKKLFILSLAAIGFVACSKRADYIVLSGKVEGTNGIPLELKIIGGEVDQPLHIKPDGTFQDTLRVPSNYYTIFNPQGI
    EIPLYLEQGDELGVNIDLTKMPLEIKFSGKDTLANAYLHKKADLTMEIQKSGGMQQLLVKAPAEFKTAVNEYSKKYTDLL
    KNTKNLSKDFVKKEEKAINYEMLYLKSIYQNAHQKLTQEEVTLPKEFADELAKIDYDIAEDYNTYRAYKELVTNKLFDKF
    QDNENDENPWGKLIAHVKGLKSKNIKADLTRYFISGVSVANTPEENAELIKSIKENVKDTAALKELDRRIAVLERLKPGT
    DFPPFTAEDLNGKPVSYESLKDKLLYIDVWATW
    CKPCIKEIPSMKALQEAYKGKPVTFVSISVDQDKEAWKAAVQREKLS
    GIQLYTNLSMNRDFIDNYDLSGIPRFMLVKNGKIISISAPKPSDAKVKELINANL

    >gi|256819027|ref|YP_003140306.1| conserved hypothetical protein, secreted [Capnocytophaga ochracea DSM 7271]
    MTKKLIAIVAFVLVATATLEAQEIKWMTFDQAIAAQKKKPKKIFIDVYTNWCGPCKMLANNTFKNKDLVKYVNDNYYAVK
    FNGEGNEVANYKGQKFENKGYDPALAERRNATHPLTGYMQVQAYPTMVFLDENNDLITGITGYMSPTQLELYLKMFNNND
    YKKITTQQEFQVYQSKFKPTFKN

    >gi|256819083|ref|YP_003140362.1| Peroxiredoxin [Capnocytophaga ochracea DSM 7271]
    MENLQAQNNADNQTIYQFTVEDINGKPFVLADLKGKKVMIVNTASKCGLTPQYKELEALYKQYKDKDFVIIGFPANNFLG
    QEPGSNEQIASFCSINYGVTFPMMSKISVKGKNMHPLYQFLTQKSKNGVEDSKVKWNFQKYLIGRDGKLEKVIDPKTLPS
    SDEVIQWIEK

    >gi|256819088|ref|YP_003140367.1| heavy metal translocating P-type ATPase [Capnocytophaga ochracea DSM 7271]
    MEYNIEGMGCRGCANTIQKKLSEVAGVTAVTVDFATKKATVETDREIPFEALEKALEGTHYSIHQASNSEGSGVFYCPMH
    CEGDKTYDHPGDCPICGMHLVEQVGGAQQQHHHHEETPKKAKGSGVFYCPMHCEGNKTYDHPGDCPVCGMDLVEQVSTEA
    PEGESAEEQKRKKLRRHFWGAVAFTLPIFIIAMIGMWHNNPLYELMPVSAWNWVQFALSLPVVFYFCWIFFERAWRSIRT
    LHFNMFTLIGIGAGVAWLFSVVGLLVPDMFPEQFKEHGSVHLYFEAATVILTLVLLGQVLEADAHSRTQGAIKKLLNLAP
    NEATKIVHGEEIRVSIEEVTLGDLLRVKPGEKIPVDGVITEGSASIDESMITGEPIPAEKEVGSKVSAGTLNGAQSFVMK
    AEKVGSDTLLSQIVQLVQQASSSRPPIQNLADKIASYFVPIVIGISVLTFVIWSVFGGENAYVYALLNAVAVLIIACPCA
    LGLATPMSVMVGVGKGAQNGILIRNAEALEVMNKVNTLVIDKTGTLTEGKPSVSEVFTFGNRSEKDLLQVLYSLNQHSEH
    PLAKATNAYTQAQGATPLSFTNFEALAGRGVKASYEGKNFFFGNERLMEEIGAPLSEEIQTVVKTAQAAGKTVSLLAIEK
    EIIGVVTITDRVKTSTVQALQELQDLGVEIVMLTGDNSLTAAAIAKEIGISNYKAGMLPQNKQAEVARLQAEGKIVAMAG
    DGINDAPALAQANVGIAMGTGTDIAIESAEITLVKGDLNGIVKAKKLSKAVMKNIHENLFFALVYNVVGIPVAAGVLYPI
    FGILLSPMLGALAMSFSSVSVISNALRLRRTKL

    >gi|256819118|ref|YP_003140397.1| Redoxin domain protein [Capnocytophaga ochracea DSM 7271]
    MKQLFIAFLIVLGLSACTNPEEAIKAYQQQKEAIGLQTPEKQNELLGQNPVAFQQNLQAISKQCAEVLTNAKGLPSDFIV
    KEEKENQYELLSLTSAYLLNHRKYTEEEAPAIKVLEESLKDVDLDNATDFDAYNAYKTLVHNCFQLKIYRYQVQYEFNDP
    WGKILADFKTLKSQNIKEDLTPLLIEGVSATSAETTNEQIIALVQKAVKDNELLNALSGRIATVNRLKAGQPFPLFKGLT
    DLNDKEVKYESLPLKGKLLFVDIWATY
    CPDCRKELPALEALQQSYKGKPIVFLSISVDRDKEAWKEMVKNDKLSGIHLYT
    TPEVKDTYKFLYDLRSIPRYMLIDAQGNIINSNAPMPSDENLKKLIDTHLMAINNPKAK

    >gi|256819146|ref|YP_003140425.1| thioredoxin [Capnocytophaga ochracea DSM 7271]
    MALEITDGNFEDLVLKSTQPVLVDFWAVWCGPCRMLAPVVEEISKEYEGRVVVGKVDVDNNQEFAAKYGIRNIPTVLVFQ
    NGEVVGRQVGVAPKKTYTDALDGLLS

    >gi|256819191|ref|YP_003140470.1| Redoxin domain protein [Capnocytophaga ochracea DSM 7271]
    MANITFHEQPAHTVGELPKVGTIAPNFSAVRNDLAEVTLKDFQGKKVVLNIFPSVDTGVCAASVRKFHVEASKLSNVAIL
    CVSKDLPFALTRFCAAEGIDNLTMLSDFRGDFAKHYPIVFTDTPLKGLLSRCVIVLDEQGKVVYTEQVAETTHEPNYVKA
    LEALK

    >gi|256819217|ref|YP_003140496.1| protein of unknown function DUF1573 [Capnocytophaga ochracea DSM 7271]
    MKKFLTFVFLAFFGVMAYAQDAEISFKSEEIDYGNIKQGADGVRVFEFTNTGKAPLVITNVASSCGCTVPSWTNQPVAPG
    AKGKIEVKYDTNRVGPISKTITVTSNAKSSPVKGLRIRGNVQ

    >gi|256819609|ref|YP_003140888.1| Thioredoxin domain protein [Capnocytophaga ochracea DSM 7271]
    MTELTQDNLQEIIASNPLVFVQYGAGWCGNCKIMKPKFKKYASETPNATFIYVDAEAFAESRKLAKVDNLPTFAAFKNGT
    LVNQIQTNKAELLKLFIDEITGN

    >gi|256819610|ref|YP_003140889.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Capnocytophaga ochracea DSM 7271]
    MSFVGKQFPNIEVNAMSDLGDTFKINVLSEAVNNKKKVLLFWYPKDFTFVCPTELHAFQEALAEFEKRNVKVIGASCDTP
    EVHFAWLNTPKNNGGIEGVTYPILADSNRNLARILGILDSREIYDETADAYLLEGDDVTFRATYLIDETGKVFHESINDM
    PLGRNVKEYLRLVDAYTHVQQHGEVCPANWEEGKEAMHADRKGVASYLASH

    >gi|256819640|ref|YP_003140919.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Capnocytophaga ochracea DSM 7271]
    MRKRFLFTALALFFLATAESFAQALQRHNLVPEINLPQPNGEKLALSSLRGKYVLVDFWASWCMPCKKENKYLKQAYKEF
    KGKNFVILSVSIDRPKDKDAWQDAIKIEGMVWHNVWDNDGKTAEKYGVTSIPAPFLIDPEGNLLSQGDNLRANDLMKTLK
    KYIK

    >gi|256819882|ref|YP_003141161.1| methionine-R-sulfoxide reductase [Capnocytophaga ochracea DSM 7271]
    MAIAFTTGCANGNSQRTTPLNTNDENSTHQQAEMKKTNKSKSTDIYFAGGCFWGTEHFFKQIRGVLATEVGYANGKLSKA
    PSYEQVSTGNTGFAETVKVTYNPQLINLNQLLDLYFKIIDPTSLNKQGNDRGTQYRTGIYYVNETEKPLIDKAIATLATQ
    YSKPIVVEVLPLKNFYKAEEYHQAYLDKNPQGYCHISPALFEIARKANPVKQKGFKKPSQADLRKQLTPEQYAVTQESAT
    ERPFANAYYNEFREGIYVDITTGEPLFISTDKFESGCGWPSFSKPIDKKLIEEKTDKSHNMTRTEVRSKLGNAHLGHVFN
    DGPKDKGGLRY
    CINSASLRFIPKADMEKEGYGKYISLLEKKTKK

    >gi|256820127|ref|YP_003141406.1| OsmC family protein [Capnocytophaga ochracea DSM 7271]
    MTAMYTAVATATGGRNRKVTSDNGVLSLEIRSPKALGGANDDYTNPEQIFAAGYAACFDSALNLVIRQTKITTGETAVTA
    HVSIGKLNNGGFIFGVTLQVNIPNVSLEQAKELVAKADQV
    CPYSNSTRGNIEVTFEVSNN

    >gi|256820182|ref|YP_003141461.1| thioredoxin reductase [Capnocytophaga ochracea DSM 7271]
    MANIEKIKCLIIGSGPAGYTAAIYASRANLSPVLYQGEQPGGQLTTTNEVENFPGYPEGVMGSEMMIQLEQQAKRFGADI
    RNGWVTKVDFSAHPHKVWVDDQELHADAVIIATGASAKYLGLPSEQHYLQTGGGVSA
    CAVCDGFFYRNQHVAIVGAGDSA
    CEEALYLANLCSKVTMFVRRDEFRASQIMKERVLNSPKIEVLFNTETEEILGDGQVVTGIKVRNNKTGEISEIAITGFFV
    AIGHKPNTDVFKPYIDTDEVGYIKNVAGTSLTNVAGVFVAGDAADTRYRQAITAAGSGCMAALDAEKYLLTLE

    >gi|256820336|ref|YP_003141615.1| Rhodanese domain protein [Capnocytophaga ochracea DSM 7271]
    MKFIITMSTLILCSVTAQAQTLAERINASNVTLVDVRTPKEYAAGTAEGAINIPLEEMGARWQELKGKENIVLFCRRGIR
    AGKAQDILKMHNITAVNGKTVEHVKSLQKVNLADKLTFKTDKPTTYFVKDGKNVRQVAIALGEGGVLKKHTTSIPATLIM
    VKGTVRFLINGEEIVLKDLDTYQIPVDVEHEVIGVEKENVFIVTKGD

    >gi|256820373|ref|YP_003141652.1| cytochrome c biogenesis protein transmembrane region [Capnocytophaga ochracea DSM 7271]
    MKKIITLIFVVLVAIANAQIHNPVKWKTAVEKISDNEYYLVATASIEAGWKLYAQNIPPKGPIPTSFAFEKSANFELMGK
    TEESKPIQKHDKVFDMEIAYFHNQAVFKQRIKIVKPITSIKATVEFMSCDDSNCLPPDTVDLEFFLSGAPVASKVATPQF
    TFGNNTDGNNTVPTTTVSQTTTTKAPNTTPISRQGLWTIFFISFLSGFAALLTPCVFPMIPMTVSYFTKQSKTKAKGVKN
    AVIYGTSIIVIYVLLGSAITAIFGADALNALASNFWFNLIFFLILVVFAISFLGAFEITLPSSWSTKVDAQADRSGFIGI
    FFMALALAIVSFSCTGPIVGTLLVQAASEGGIAPIIGMFGFSLAIALPFALFAAFPGWLHSLPKSGGWMNTVKVVLGFLE
    LALAFKFLSNADLVLQYHWIEREVFIAIWIAVFGALSLYLFGKIRLPHDDATDRISVGRLLLGLLTLSFTVYMIPGLWGA
    PLNLINAFPPPQHYSESPYGVGYTADGGSTSVDEGALPEGAHLFKPHNIVTFDDYEKGLAYAKQVNKPVLLDFTGWS
    CVN
    CRKMEQNVWPNPQVLDALRNEVVLISLYVDDKRPLPESEVRPSQIREGKMIKTIGQKWSEFQTLHYKANTQPFYVLMNLQ
    GENLVDPIGYTLDTDDPDEFYQWIKQGVSAFGK

    >gi|256820564|ref|YP_003141843.1| hypothetical protein Coch_1737 [Capnocytophaga ochracea DSM 7271]
    MKKYFFIALLCWGGTALWSQNSEEISKERAGYEQPYHPEEDGDARITQLLKQAKKEHKKVLVQIGGNWCVWCLRFNHLVT
    TTPELKSILDKKYIFYHLNFSPENKNEKAFKKYGNPGAQYGYPSFLILNEKGDVLFTQKSEDLESGKGYDVKKVKKFLQG
    RL

    >gi|256820708|ref|YP_003141987.1| arsenate reductase [Capnocytophaga ochracea DSM 7271]
    MITIYHNPKCSKSRCGLELLKDLGKEYQIVDYLKKGISKEELKNLLAKLQMSPIELVRTKENIWKEQFKGKTLTDDEVIE
    AMIQYPQLIERPIVIVGDKAVIGRPTERIKEII

    >gi|256820981|ref|YP_003142260.1| dihydrolipoamide dehydrogenase [Capnocytophaga ochracea DSM 7271]
    MSKYDVIVLGSGPGGYVTAIRASQLGFKTAVIEKENLGGICLNWGCIPTKALLKSAQVFEYLKHAENYGITVKKESFDKD
    FYAVIKRSREVAATMSKGVQFLMKKNKIDVIMGYGTLKAGKKVDVKDKDGKVTEYSADHIIIATGARSRELPALPQDGKK
    IIGYRQALTLPEQPKKMIVVGSGAIGIEFAYFYNAMGTEVTIVEFMPNIVPVEDEDISKQLEKSLTKSGINIMTSAEVTK
    VDTSGKGVKAFVKTAKGEEVLEADILLSAVGIKTNIENIGLEAVGIKTERDKILVNEFYQTNVPGYYAIGDVVPGQALAH
    VASAEGIICVEKIKGMHVEPLNYGNIPGCTYCTPEIASVGLTEKQAKEKGYEIKVGKFPFTASGKANAAGTTEGFIKVIF
    DAKYGEWLGCHMIGAGVTDMIAEAVVARKLETTGHEIIKAVHPHPTMSEGVKEAVAAAYGEAIDI

    >gi|256821005|ref|YP_003142284.1| dihydrolipoamide dehydrogenase [Capnocytophaga ochracea DSM 7271]
    MKTYDIVIIGSGPGGYVAAIRAGQLGFKTALIEKYNTLGGTCLNVGCIPSKALLDSSHHYENASKHLEAHGIEITGKVKF
    SLEKMIARKAAVVEQTCAGVKFLMEKNKVDVFTGVGSFVSPTQIKITPNKGKAETIEAKHTIIATGSKPASLPFIALDKE
    RIITSTEALQLKEVPEHLIVIGGGVIGLELGQVYSRLGAKVSVVEYTDSIIPTMDRGLGRELTKVLKKQGFAFYTGHQVK
    EVTRKGKTVTVKATTSKGEELTLKGDYCLVAVGRRPYTEGLNLEVVGVQKDERGRVIVNDHLQTNVPNIYAIGDVVRGAM
    LAHKAEEEGVLVVEQLAGQKPHIDYNLIPGVVYTWPEVASVGKSEEQLKADSIAYKVGQFAFRALGRARASMDTDGFVKI
    LADTQTDEVLGVHIIGARAADMIAEAVTAMEFRASAEDIARICHAHPTFTEAIKEAALATTENRAIHS