Actinobacillus pleuropneumoniae serovar 7 AP76 uid59231

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|190149323|ref|YP_001967848.1| glutaredoxin [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
    MFVEIYGRMTCPYCTRAKALAEKMKGELADFDFKFIDMIAEGISKEDLEPRVGKPVATVPQIFLDNVHVGGCTDFQALVK
    EKFGIEV

    >gi|190149342|ref|YP_001967867.1| monothiol glutaredoxin-like protein [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
    METIDTIEKIKKQIGENPILLYMKGSPKFPSCGFSARAVEAVINCQVPFGYVDILTNPDIRAELPKFANWPTFPQLWVEG
    ELVGGCDIVLEMFQKGELQTLLKEVAAKHA

    >gi|190149348|ref|YP_001967873.1| thiosulfate sulfurtransferase GlpE [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
    MSETFTEISPHQAWELIENEGATLADIRDGHRYAYSHPQDAFHLTNESYGRFLDEVDYEEPVIVMCYHGVSSRNTAQFLV
    EQGFDRVYSVKGGFDGWERSGLPIETAY

    >gi|190149353|ref|YP_001967878.1| Thioredoxin reductase [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
    MTVKHAKLLILGSGPAGYTAAVYAARANLNPVLVTGMQQGGQLTTTDEIENWPGEYEHTTGTGLMDKMLKHAEKFNTEIV
    FDHINSVDLSKRPFTLKGDINTFTCDALIIATGASAKYLGLPSEEAFKGKGVSA
    CATCDGFFYRNKPVAVVGGGNTAVEE
    ALYLANIASEVHLVHRRDSFRAEKILLGRLQKRVEEGKIILHTDRTVEEVLGDNMGVTGVRLASTKDESKEEIKVDGFFV
    AIGHAPNTAIFDGQLELDNGYIKVKSGLEGNATATSVAGVFAAGDVMDHNYRQAITSAGTGCMAALDAERFLDALEA

    >gi|190149424|ref|YP_001967949.1| Na(+)-translocating NADH-quinone reductase subunit D [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
    MASNNLKKLLLSPIADNNPIALQILGICSALAVTTQLQTAVVMAIAVSLVTAFSSMFISMIRNYIPNSIRIIVQMAIIAS
    LVILVDQILRAYAYELSKQLSVFVGLIITN
    CIVMGRAEAFAMKSGPVESFVDGIGNGLGYGAMLIIVAFLRELIGSGKLF
    GVTILQTVQDGGWYQANGLFLLAPSAFFIIGFVIWGIRTWKPEQVEK

    >gi|190149425|ref|YP_001967950.1| Na(+)-translocating NADH-quinone reductase subunit E [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
    MVCVHSLRCLRSFNCFWFRYAVIVVLGIAVPANQLVYTHVLKDGALVEGVDLSFLNFITFIGVIAALVQILEMILDKFFP
    ALYSALGIFLPLITVN
    CAIFGGVSFMVQREYNFTESVVYGLGAGTGWMLAIVALAGLTEKMKYSDVPAGLRGLGITFITV
    GLMALGFMSFSGIQL

    >gi|190149437|ref|YP_001967962.1| electron transport complex protein RnfA [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
    MVDYILLIISTALINNFVLVKFLGLCPFMGVSKKVETAIGMGMATTFVLTVASLSAYLVETYVLIPLEAQFLRTLVFILV
    IAVIVQLTEMIVHKTSPTLYRLLGIYLPLITTN
    CAVLGVALLNVNLSNNLVESVLYGFGAALGFSLVLVLFAALRERLAA
    ADVPSPFQGASIALITAGLMSLAFMGFTGLVKSNVSISYYCVYPDCDCRDRTDFRCDFGLFVDQIKS

    >gi|190149442|ref|YP_001967967.1| electron transport complex protein RnfE [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
    MNTENQIPVTEIDTTTPAEPSIWRNLLAEGVWKNNGALVQLLGLCPLLAVSNNVTNALGLGLATLLVLVCTNTMVSLFRK
    FTPNDIRIPIYVMVIATVVTAVQLLMNAFAYPVYQSLGIFIPLIVTN
    CIVIGRAEAFASKNSVAHSAFDGFAMGLGMTLS
    LVALGAMRELIGNGTLFDGLDLLLGDWAKSLRIDVLHLDSGLLLAILPPGAFIGLGVILAVKNLIDKK

    >gi|190149585|ref|YP_001968110.1| molybdopterin biosynthesis protein MoeB [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
    MELSDQEMLRYNRQIILKSVDFDGQEKLKASRVLIVGLGGLGCSAAQYLASAGVGHLILVDFDEVSLSNLQRQILHTDAN
    IGQPKVESAKVRLSQINPHIQLEAINKQCSDAEFAELIERVDLVVDCTDNATVRNQLNLQCFAQKRPLVSGSAIRFEGQI
    SVFTYAENKPCYNCLSRLFGDGTLS
    CVEAGVIAPIVGVVGSLQALEAIKLLLNIGKSLSGKLLMIDGLYFSVREMNLPKL
    QDCEICCQ

    >gi|190149595|ref|YP_001968120.1| disulfide bond formation protein B [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
    MLSYFKELSLNRTAWLLLAFVAFALEASAIYFQYGMGLVPCVMCVYERLAIFGLLIAGLVGAISPRFFLTRWLALLLWGF
    SAFKGLALAIKHHDYQANPSPWNQ
    CEFKPEFPQTMPFDQWFPSIFAPGPVNCSEKQWEMFGLGMPEWLILAFSIFALMFV
    IVLLSQFKRAKPQYRSVFR

    >gi|190149777|ref|YP_001968302.1| methionine sulfoxide reductase B [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
    MIKDIDELTEEQVEILINHGTEMPYSGKFLNENRIGTYRCARCHNALFRSDTKFDAGCGWPSFYEAISDDALRYLDDYSL
    GRHRTEIRCGNCDSHMGHVFNDGPPPTGLRF
    CLNSIALNFKWDETGEEIDG

    >gi|190149804|ref|YP_001968329.1| thiol:disulfide interchange protein DsbC precursor [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
    MKKNVTALFSVSLMGLCVSPVMADDMSLVKTLEGMGATNVKISDSALPGFRTAVSNEGVVQISENGRFVIQGQIFELKNG
    KAVNITNKSLLADLNALEKEMIIYPAKNEKHVVTVFMDIT
    CHYCHLMFQRIKEYNDLGITIRFLAFPRGGMNTQTAKQME
    AIWTSADKVKALTDAENGTLPKEVKTPNIVKKHYELGIKFGVTGTPNMVDSTGQLIAGYVEPKELLKMLSE

    >gi|190149824|ref|YP_001968349.1| hypothetical protein APP7_0555 [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
    MFTNWKEQTQITKQAFGKMAQAHPKMLQAMGALNAASAEEGLDAKTRELIALAVAITTRCESCISVHAEAAIKAGATDKE
    IAGALATAIETNAGAAYAYALRAFEAVETQR

    >gi|190149841|ref|YP_001968366.1| predicted dinucleotide-utilizing enzyme involved in molybdopterin and thiamine biosynthesis [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
    MKDLNKPKSEQARLNLQAINPSVEVVAINKQLTTDNLTYWVNKVNVVLDCSDNMATRHAVNKVCVENQIPLISGSAVGMD
    GQLLGVFPPYQHGCYACLFPDTEIGNLN
    CRTAGVLAPIVGIIGSLQALETLKFLLGLAVSCDGKFYVFDGRTLMWQ

    >gi|190150101|ref|YP_001968626.1| dihydrolipoyl dehydrogenase [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
    MSKEIKTQVVVLGAGPAGYSAAFRCADLGLETVIVERYSTLGGVCLNVGCIPSKALLHVAKVIEEAKHAEKNGITFGEPN
    IDLDKVRAGKEAVVSKLTGGLAGMAKARKVTVVEGLAAFTDPNTLVARDRDGNPTTIKFDNAIIAAGSRPIQLPFIPHED
    PRVWDSTDALKLKEVPKKLLIMGGGIIGLEMGTVYNALGSEVEVVEMFDQVIPAADKDVVAIYTKQIEKKFKLMLETKVT
    AVEAKDDGIYVSMEGKACNDTKRYDAVLVAIGRVPNGKLIDAGKAGVNVDDRGFIAVDKQMRTNVPHIFAIGDIVGQPML
    AHKGVHEGHVAAEVIAGQKHYFDPKVIPSIAYTEPEVAWVGKTEKECKQEGLNYEVAKFPWAASGRAIASECSEGMTKLI
    FDKDTHRLLGGAIVGSNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEVFEGSITDLPNAKAKKR

    >gi|190150172|ref|YP_001968697.1| putative peroxiredoxin Bcp [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
    MNTLKAGDKAPQFTLLDQHEQPVSLSQFAGKKVLVYFYPKALTPGCTTQACGLRDSKSELEQLNVVVLGISPDLPKKLAQ
    FAEKKALNFTLLSDADHQVAEAFGVWGEKKFMGRTYDGIHRISFLVNEQGVIEQVFDKFKTGEHHQIVVDFVKGTK

    >gi|190150256|ref|YP_001968781.1| iron-binding protein IscA [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
    MAITLTETAANRVRTFLENRGKGIGLRLGVKTSGCSGLAYVLEFVDVLNEDDHVFEQHGVKVIVDEKSLTYLDGTELDFV
    KEGLNEGFKYNNPNVKDSCGCGESFNV

    >gi|190150261|ref|YP_001968786.1| methylated-DNA--protein-cysteineS-methyltransferase [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
    MKSTIYYQYYDSPVGKLLLIANDKGLIGIEFEQEQLTSDAQKWQEANETSGQIFEIFCKTRDILDRYFAGEKLEFRHLDF
    LAPQGTEFQKSVWQILLTIPYGKTTSYGEIARQLGKPNAMRAVGGAVGRNPISIIVP
    CHRVLGKSQTLTGFGGGLPAKRY
    LLALEGIHFKDKGIEFVNPKHKKWDKA

    >gi|190150349|ref|YP_001968874.1| peptide methionine sulfoxide reductase MsrA [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
    MTTYNKRSNSVKILQTGENMANIREIYLAGGCFWGTEAFMQRINGVLDAQSGYANGNTENPSYQEVCAGSGHAEVVKVTY
    DADKISLAKLLDYYFKVIDPISVNQQGADKGIQYRTGIYYVDPQDVPVINQALADLQAQYAEPLAVENMMLEHYFPAEEY
    HQDYLDKNPNGYCHIDLQLMNEILRNQ

    >gi|190150376|ref|YP_001968901.1| disulfide bound formation protein E (dsbE) [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
    MKKTFLFLPLLLLIALVAFLTVPLMNKDALSPTEDWRDKPFPEFVGKNLLDHNAHINNNSLPKEPYILNVWASWCTWCIK
    EFPILLKLKEQGVPIVGLTYSDQPKDAREALARWGNPFDLVIDDYEKGFLIQTLKVSSAPSSYLIDKHGVVRYQQKGYNP
    DFEQDFLPRLKALQEEK

    >gi|190150400|ref|YP_001968925.1| hypothetical protein APP7_1131 [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
    MSKFQIHTIETAPEASQEALKAVKQANGFIPNLIGVLANAPTALETYRTVSGINGRNSLTPLEREVVQITAAIVNGCGFC
    VAGHTKIALKALNAPKEIVDQIRATARISDPKLDTLARFTLAVMLQKAKLTEAQLNEFFAAGYNQQNAIDVILGVSLATL
    CNYVNNIAETPINPELQDFA

    >gi|190150405|ref|YP_001968930.1| thioredoxin [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
    MTLQVTDATFEQEVLKSDVPVLLDFWAPWCGPCRMVAPILDELSEEFAGRAKIAKVNVDENQQIPAQFGIRSIPTLILFK
    NGEVVATQVGALPKSQLSAFVEQAL

    >gi|190150416|ref|YP_001968941.1| arsenate reductase [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
    MEKVTIYHNPKCGTSRNTLALIRHLGIEPTIIHYLETPPDEATLRNLITEMGICVRDLLRTNVPPYEALNLSRMELSDDE
    LIASMLAEPILINRPIVITSKGVRLCRPSEKFLEISPVSLDKPFIKEDGGVIEL

    >gi|190150544|ref|YP_001969069.1| hypothetical protein APP7_1275 [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
    MQKLLFIFNSAPYGNESFFSGLRLALQIQEQHKAQLKLFLMSDSVTAALRKHNPSEGYNLQQMLEILTAQGATIKLCKTC
    INARGMSALPLADGVEIGTLIELADWTMEADKVLNF

    >gi|190150545|ref|YP_001969070.1| Putative flavoprotein [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
    MQHFDVVIIGAGASGLFCAAQLGQAGKRVAVLDSGKKIGRKILMSGGGFCNFTNLEVTANHYLSQNKHFVKSALARYTNW
    DFIALVAQYGISYHEKELGQLFCDESSQQIVDLLQAECDKGKVEIFLRQAVIFVEKFAKNFQIQTASETFETEHLIIATG
    GLSMPALGASPFGYKIAEQFNIPVIPPRASLVPFTWKDSDKHFATLSGIALPIRATCGQQSFSNQMLFTHRGLSGPAILQ
    ISNYWDLGETVEIDLLPADDISTILTELRQSSPKLQLKTVLNRYLPKKLVELWLEQGAFKDNVIVQLSKAELARLDQLIH
    HWQFLPNGTEGYRTAEVTMGGVDTDFISSKTMQAKHTEGLYFIGEVLDVTGWLGGYNFQWAWSSAFACAEAIIEK

    >gi|190150562|ref|YP_001969087.1| glutathione reductase [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
    MTKHYDYLAIGGGSGGIASINRAASYGKKCAIVEAKHLGGTCVNVGCVPKKVMFYGAHIAEAINSYAPDYGFDVTVNNFD
    FAKLIESREAYISRIHTSYNNVLAKNNVDVLNGFAKFVAAKTVEVTYADGSSEQVTADHILIATGGRPSIPAIKGAEYGI
    DSDGFFALREVPKRVAVVGAGYIAVEIAGVLNSLGSETHLFVRQHAPLRMQDPLIVDTLLEVLAQDGITLHTQAIPQEVR
    KNADGSLVLTLADGREATVDCLIWAIGREPACDKINLDAVGVKTNAKGQIIVDKFQNTNVPNVYAVGDIIEGGIELTPVA
    VAAGRRLSERLFNNKPNEHLDYNLVPTVIFSHPPIGTVGLTEPQAIEQYGAENVKVYKSSFTAMYTAVTQHRQPCRMKLV
    CVGKDEKVVGLHGIGFGVDEMIQGFAVAIKMGATKADFDNTVAIHPTGSEEFVTMR

    >gi|190150583|ref|YP_001969108.1| Putative cation transport ATPase [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
    MSITLKLDGLHCGNCVKSVEKALNAVEGVTKATVTLDPQQAIVEGSANAETLIAAVDDIGFEAEVI

    >gi|190150584|ref|YP_001969109.1| copper-transporting P-type ATPase [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
    MAKEQQLLIDGMHCAACVRRVEKILMKVEGVTFASVNLADQTAFVQGEADPQAMVQAVEKIGFGAEILESEQERRAKQQA
    QTQRTLSHKKWQFIMALIVGFGLVVLGLVIGMIPNSTNLMYWFIAAAVSLFTMYFAGKDFFIGAWVSLKNKASTMDTLVA
    LSTGVAWLYSFWLTLFPQPQAHVYYEASVMIIGFINLGKFLELKAKQRSSLALEKLLDLAPQQAVVFDRNNAAQTIPVKG
    IKPEMRVQALTGDRLAVDGRLESGSIWVDESMLTGEALPIEKKVGDKVRAGTLIQDGAGIYIAEQVGSQTALARVINAVR
    HAQSSKPPLAQFVDKVASVFVPVVVSIALISGLVWLFLGKDFSFALSIFTTVLIIACPCALGLAIPLSTIAGVARAAEFG
    VLVRNIEALQASSEIDTLVFDKTGTLTTGEMTVSDIQTFNGFEPNQVLQLAKSLEVHASHPIAKAIVKFAENQTACEVTN
    VQVVKGAGIVANLGEDQIKVGNTKFVNFSGNLTASRSTQIFVAINDQLAGILSVEDQLRDESKAMIEKFKAQGYQCLMLT
    GDRQATAEYFAQQLGLDGVIAEVSPEQKADKIRELQAQGKKVAMIGDGINDAPALAQANVGIAMHNGSDIAVETADLSLM
    QHGLAPVLQILPFAKRVLRNMKQSLLGAFMYNVIAIPLAAGVLYPFTGWLLNPMIAAIAMTMSSITVVLNSQRLLK

    >gi|190150603|ref|YP_001969128.1| putative DNA-binding protein [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
    MFQDWKAHTAHVKKSFGALGAKHPKMFEAYQALGAAAAAEALDHKTRELIAIAVAVTTRCDSCISVHAEEAAKAGATESE
    IAGALATAIALNAGAAYTYSLRALEAVAVQDE

    >gi|190150604|ref|YP_001969129.1| hypothetical protein APP7_1335 [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
    MNKLTYLLGALVLATPVLTQAAEMKETEQTMQNAPLKAKGIWIDVRTADEFQQGHLDGSINIPFEQIADHISKVSPNKDE
    PVHLY
    CRSGRRAETALQTLKQLGYNNVTNHGGYQELIEKGYK

    >gi|190150679|ref|YP_001969204.1| thiol:disulfide interchange protein DsbD precursor [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
    MKTRKLIMALSSNFLNTKCHFMSIFLRNIHDFCCKKQAFCLTLLIYITIRHLLSFYIDMLKRFIFLLVGITLTLSAHAGL
    FGNDQPKYLSGAEAFAFSATPKSDKQIELNWQIADGYYLYKKEIQVTPQNAEIQPLTFPAAENYHDEFFGEVEIFRDQLT
    LPITFSAAQANASLSVRYQGCTKGFCYPPETVTVSLDGQQAVDSAQNIAKNSENSTASQPLANAPKAEQDQLAENLANNR
    LSIFWFFLLGIGLAFTPCVLPMLPLLSAIVIGNKQRPNTFKALLLSFAYVQGMALTYTLLGLVVAAIGLPFQVALQSPPV
    LISLAILFTILAASMFGLFEIRLPNSWQQKLNAMSQKQQGGAFGSVFVMGMIAGLVASPCTSAPLSGALLYVAQSGDLLT
    GGLALYLLALGMGIPLILITLFGNRILPKSGDWLLKVKTAFGFVMLALPVFLLSRILPSHYEPLMWSALAMVFVGWLISV
    IPTQGVIKQAVRIVLFLTFAVASYPWANLVWNQGNSSHSAQVSNHLAFERVQSLAELQAKLTASQGKKVMLDLYADW
    CVA
    CKEFEKYTFTDQAVQQKLAEMVVLQVDMTNNSAQNDELMKHFNVLGLPTILFFDESGKELTQSRVTGFLEANQFLNWLNQ
    L

    >gi|190150738|ref|YP_001969263.1| hypothetical protein APP7_1469 [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
    MNDIQIPIIFTDAAAKKVKSLIEGEDNPNLRLRVYITGGGCSGFQYGFTFDDQINEGDLTIENQNVGLVVDPMSLQYLIG
    GTVDYTEGLDGSRFVVQNPNASSTCGCGSSFSI

    >gi|190150756|ref|YP_001969281.1| thioredoxin-like protein [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
    MQNKYAMLSRFGKNIFFYGLMFIVLSTVIDWYRKPSAPNQFAQQVLYDLQHQPKMIAQLSHDRPMLLYFWGSWCTYCKFT
    SPAIQQFADENVPVLSVALKSGTPQDVVDYLKQEDYRFPVINDPDGVISKSWDIQATPTVLIIKDGEIVQHTTGLTSYWG
    LKVRLWLSNLT

    >gi|190150759|ref|YP_001969284.1| hybrid peroxiredoxin HyPrx5 [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
    MSLKDMTGQKVPNVTFHTRQGDAWVDVTTAELFDNKTVIVFSLPGAFTPTCSSTHLPRYNELACEFKAAGVDDIICMSVN
    DTFVMNAWKADQESENVTVIPDGNGEFTEGMGMLVGKEDLGFGKRSWRYSMLVKNGVVEKMFIEPQEPGDPFKVSDADTM
    MKYLVQGWAPKESVSIITKPG
    CPFCAKAKALLKEKGYTFEEIVLGRDASTISVRAITGKTSVPQVFIGGKYIGGSDDLAA
    YFAK

    >gi|190150818|ref|YP_001969343.1| putative thiol peroxidase [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
    MSNVTLMGNPITVAGIFPQVGDTVADFSLVNNGLENVALASFAGKRKVLNIFPSIDTGVCATSVRVFNQKAADLSNTVVL
    CISADLPFAQARFCGAEGIENVQTLSTFRNKAAHNALGVDIQSGPLAGLTSRSVIVLDENNRVLHSELVSEIKNEPNYEA
    ALAVLA

    >gi|190150843|ref|YP_001969368.1| thiol:disulfide interchange protein DsbE [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
    MNKKLLLPLIIFLGLTVTFMVQLSRNAQGDDPKKLESALVGKTIPDFRLESLLDEKQMLDQNVLKTGTPRLLTVWATWCP
    T
    CYAEHEYLTLLAKQGVEIVGVDYKDERSKAMRFLASYGNPYKANIYDPKGSLGLDLGVYGAPETFIIDGNGVIHYRHAG
    DVNDQVWNQVLKPIYEKLKQ

    >gi|190150853|ref|YP_001969378.1| glutathione S-transferase [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
    MKLYCLKGACSFVPHVALEWTGAEYQAELVSRDFIKSAEFLALNPRGAVPLLVDGDLALSQNQAILHYLDEKYPDAKLFG
    SKTLRDKAKAARWLAFFNSDVHKSFVPLFRLPSYAEGNEELTRVIRQQAAEQVLSQLATANEHLESHIFFGENISVADVY
    LYIMLNWCRMLGLDFSHLEQLSPFMQRVEANAGVDAIRVAEGLKG

    >gi|190150969|ref|YP_001969494.1| thiol disulfide oxidoreductase [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
    MLCEKLIKWVTFIFALVITCNAAATLPQAVEKIPKNVKNEPLFKDGKGYYSYKKPIDIELPKDGRVLIQYFFKYDCNICL
    NADDYLKQYARLHSDQVILQRSPVYDGNDIFTGQMHATFMQFGREDLSDLFLFDSAGRKESMSLVKSNDAIVQWLTSKGI
    DAQAFNRSFHSDEVKNRMKQAQTLFNKYKPPYVPIAVLNGKYILLQNTLYNDDYTYGVLDFLVNKLQQEQKEETK

    >gi|190150973|ref|YP_001969498.1| sulfurtransferase TusD-like protein [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
    MDYVLAVKSPVYGDQGAYLAYQVAESLLASEHNIKQVFFFQDGVGNANALVNPASDEINLVEKWQELAKLHDLPLHLCIS
    AAQRRGVVDNQTSKIQQSNLADGFILAGLGEFSQAVLKADRLLTF

    >gi|190151216|ref|YP_001969741.1| hypothetical protein APP7_1947 [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
    MVMSLSQKNSNNRFFASLTAALVAAVSSTLCCIAPLVYLVFGISSPWLVSLSEYEYLQLPLLFVSLGAFGYGFWLLMFSK
    KIICTKYCSRRTLMILYWIAFAIILFFLSYPFILPWLLA

    >gi|190151226|ref|YP_001969751.1| Thiol:disulfide interchange protein dsbA precursor [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
    MKKLALKSVLVALSTFFAVNSTAIAADPVEGKEYTQVRQAPSAQKEVVEFFSFYCPHCYDFELTYKIPSQIKQALPKDAK
    LVQYHVNFLGRQSENLTRAWALAMALGVEDKVKTALFEAAQKDAMKSMDDIKAVFTANGVSAADFDNGINSFAVNGLVNK
    QVQLAENFKIRGVPAFFVNGQYQINLEGFADSASTNEFVKRYVEAVTFLIKK

    >gi|190151231|ref|YP_001969756.1| ArsC protein [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
    MTIRVYGIKNCDTVKKALKWLTDNNISHQLHDYRIDGLSVDFLQHAETAFGWESLVNKRSTTWRNLDEAVKNNLDRATAL
    KVLQDQPTLIKRPIILQDGIALIGFDAKQYEQAFGK

    >gi|190151334|ref|YP_001969859.1| hypothetical protein APP7_2065 [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
    MLEIWQQFKQTYLIKFWNPVPAVIAAGILSAYYFGLTGTYWAVTGEFTRWGGEILQLLGVDVSGWGYFNFISLDGTILTR
    IDGLMILGMFAGCIAAALWANNMKIRMPQNKIRILQALIGGALAGFGARLAMG
    CNLASLFTGIPQFSMHAWYFTLATAIG
    TYAGVKFTLLPMFRPPLKLKKGAGKVEASNPKQAQFRFWIGVAVFTAWTIASIYVLQYSIKLGFAMLFGLGFGLLIERAQ
    ICFTSAFRDLWVSGRSHMGKAIIYGMLIGTICVFSYIQLGMEPKIMWAGPNAIIGGLLFGFGIVLAGGCETGWMYRAMEG
    QVHFMWVGVGNVIGSTLLAYLWDDLAPVLALDYEKINLLKSFGPVSGLLINYALMIACLIFIVWWEKRFIRKAKVRVAAT
    NTYTIN

    >gi|190150401|ref|YP_001968926.1| thiamine biosynthesis protein ThiI [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
    MKFIIKLFPEIMIKSDSVRKRFIKILTSNIRNVLLRETENVAVIRNWDFIEVRAKVAEEAPIVLDLLKRTPGIHHILEVE
    EMPFTTMHDIFENTLAKVRDELEGKTFCVRVRRKGKHEFRSLDVEKYVGGGLNQHIESARVKLTKPDVTVRIDIDGDKML
    LINARHEGLGGYPIGTQEDVLSLISGGFDSGVSSYMLIRRGSRVHYCFFNLGGAAHEIGVKQMAYHIWSRYSTSHKVRFV
    AINFENVVGEILEKVDNGQMGVVLKRMMVRAASKIAERFDIQAIVTGEALGQVSSQTLTNLRLIDKASDTLVLRPLITHD
    KEQIIAMAKEIGTDDIAKSMPEFCGVISKNPTVKAIESKIVEEEGHFNFEVLEQAVANAQFLDIREIAQQTEQEVVSVET
    TSELTENDIILDIRSPEETDEAPFSLDGVEVKLMPFYKLSSQFASLDQSKNYLLY
    CQRGVMSKLQALYLKENGFSNVKVF
    RH