Candidatus Vesicomyosocius okutanii HA uid59427

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|148244216|ref|YP_001218910.1| thioredoxin-disulfide reductase [Candidatus Vesicomyosocius okutanii HA]
    MSENKHCKVLIIGSGPAGYSAAVYAARANLTPVVVSGMEQGGQLMNTTDVDNWPGDDAGVQGPDLMARMKKHAEYFDTQV
    INDTIISVNFVKRPFVLKGEIITYTADSVIIATGASARYLGLESEEEFKGKGVSA
    CATCDGFFYRGKKVAVIGGGNTAVE
    EALFLSNIVDHVTIVHRKHKFSSEKILSDQLIEKARTGNITIEYNHNLDEVLGDVNGVTGIRLKNNNNKIKDIDVHGVFI
    AIGHTPNTAIFKGHLEMINDYIKVQSGTQGNATQTSIEGVFAAGDVSDYVYRQAITSAGSGCMSALDAERFLGE

    >gi|148244267|ref|YP_001218961.1| peroxiredoxin [Candidatus Vesicomyosocius okutanii HA]
    MNVLVTQQAPDFKAAAVLADGTIVNNFQLSDFKGKKIVLFFYPLDFTFVCPSEILAHHHRMMQFNEKGVKVVGVSVDSQF
    THNAWRKIDPMDGGLGVIDFPLVADTNHSIMKSYGIVHPTGVALRASFLIDESFDIRHQVVNDLPLGRNVDEILRMVDAL
    DFHSKHGEVCPAGWNDGDEGMKDTPAGVANYLSQYADKL

    >gi|148244306|ref|YP_001219000.1| electron transport complex protein RnfA [Candidatus Vesicomyosocius okutanii HA]
    MNEYVLILVSTILVNNFVLVKFLGLCPFMGASRNIDTAIGMGFATTFVLTLASISSYLINTYVLVPFEMEYLRTIAFIVT
    IAGVVGFTELVVNKTSPTLYQSLGVFLPLITTN
    CAVLGVALLNVNQDNGFLASGVYGFGVAIGFSFVLVLFSTIRERIDV
    ADVPLTFKGVPIALITAGLMSMAFMGFIGLV

    >gi|148244435|ref|YP_001219129.1| glutathione oxidoreductase [Candidatus Vesicomyosocius okutanii HA]
    MNKDYDMIVIGAGSGGLSVIERAAEYGKKCLVIEVKTIGGTCVNTGCVPKKIMWFAANTGTIIKNSKGFGFDVEQKGFSW
    KKLKTKRDNYIKSITNWYKEHLEKLGIDYIQGFGKLVNKNTVSVNDKQYTAHHIVLSPGGEPSVPHIKGAKYGITSDGFF
    TLEELPKKVAVIGSGYIGIELAGMLNSLGSKVAIFSRANKLLRGFDYMIQDALNKDYLNHGITIHHNTQIKKISKDKTIL
    TNKGEFSGFDTIIWAVGRNPITKYLGLDNVGVKYDQKGFIPTDKFQATNIDNIFALGDATPQTPLTPVAIAAGRRLSDRL
    YNNMVNRHLDYNNIATVVFSHPPIGTIGLTETQANKKFNKVKIYKSEFTPMADALLNHKTTTVLKLVCMGDDEKIIGCHL
    MGHGIDEMLQGFAVAIKMGATKAQFDDTIAIHPTSAEELVTMR

    >gi|148244461|ref|YP_001219155.1| thioredoxin [Candidatus Vesicomyosocius okutanii HA]
    MTKNSIIPTNYLFQLSNKIIKFSFICLLFVTLNIAQANNINDIVKSANDIWREERKIKVPNFYLTDLDDNIYTNKSTKGK
    YLVINFWATW
    CPPCLKEIPTFIKFYEKNKDRIIILGLNYEQADKIAIMEFTDTFMVNYPIVLFNDKNRTQFKKFGEIVGM
    PTTYIYGPNGNLVDYQIGEMNMKDLEKAISK

    >gi|148244462|ref|YP_001219156.1| arsenate reductase [Candidatus Vesicomyosocius okutanii HA]
    MSIIIYHNPKCSKSRTTLAILEQKNVDFEIIKYLENPPTINELKQLLIDLKLEARLLIRKGELEYKEKGLDDKHLTEDQL
    ISAMVKTPKLIERPIVRTSKGVVIGRPPENIFSIL

    >gi|148244463|ref|YP_001219157.1| glutathione S-transferase [Candidatus Vesicomyosocius okutanii HA]
    MKLELISFKLCPFAQCAIILLNKQELAFELNYINSINLPNWFKQISPTGKVPLLKANDKIIFESSVITEFINDISKTNLH
    PSDPIKKAKNRSWIHFSSTLFDDLFDVITGDKEKFYTSKKSLFDKLSKIEAVKNNSQFFNGDDFSIIDATFAPIFMRLSW
    INKFTNNTLSFDRLTNIKAWSQDLLQVDIVKNSVVKNLDDVYYSNIETRKGHISTLFID

    >gi|148244518|ref|YP_001219212.1| glutaredoxin-related protein [Candidatus Vesicomyosocius okutanii HA]
    MDVMDRIQHQVDSAAVVLYMKGTPQFPQCGFSAKAAQTLTSTGVEFAYVNIFEDQEVFQSLPTFANWPTFPQIYFNSELV
    GGGDIIVEMAEMGTLKDEMKKASEKFDVK

    >gi|148244588|ref|YP_001219282.1| thioredoxin 1 [Candidatus Vesicomyosocius okutanii HA]
    MNDKIKIVVDASFEAEVVNSSQVVLVDFWAQWCGPCKTLMPVLDKIADEYDGRVLIAKINIDENQKIPSKYGIRGIPTML
    LFFEGVVQATKMGALSKAELSAFIDANI

    >gi|148244678|ref|YP_001219372.1| iron-sulfur cluster assembly protein [Candidatus Vesicomyosocius okutanii HA]
    MAVTLTEHAVERIVEFLTNRGSGIGIRLRVQTTGCSGLGYNMEFVDYTFDDDTVFEDNGVKIIVDAKSLIYLDGTQVDYV
    KKGLNEGFEFNNPNAKAECGCGESFTV

    >gi|148244707|ref|YP_001219401.1| AhpC/TSA family peroxiredoxin [Candidatus Vesicomyosocius okutanii HA]
    MNKVQPITCTATSNLKISIPDTKGRNIVLYFYPKDSTPGCITEGQNFRDKHQAFLDANTVIYGVSKDDLTKHEKFKAKQN
    FPFELIVDINGTLCELFNVWQLKKFIGREYMGIVRSTFLIDANGNILKHWDKVKVKGHVEEVLIFTQAL

    >gi|148244731|ref|YP_001219425.1| molybdopterin biosynthesis protein MoeB [Candidatus Vesicomyosocius okutanii HA]
    MNDQELLRYSRQILLPQISIKGQQSLKDSTLLLIGMGGLGSPSALYLASAGIGHLIIADSDKVELSNLQRQIIHSTDDIG
    RTKVNSAKDKILAINPNIKVTTIGKLSQDNLNNWVAKVDVVLDGTDNFDIRFKINKACVMQRTPLVSAAVIRFEGQLSVF
    QGYNQTKPCYQCLYSIEGNSDEN
    CTRNGILSPVTGIIGSLQALQAIKVLLNLGEQLVGKLMLIDTLNLSFKKIKINKDES
    CKICSHGV

    >gi|148244732|ref|YP_001219426.1| peptide methionine sulfoxide reductase MsrA [Candidatus Vesicomyosocius okutanii HA]
    MQTAYFSGGCFWCVEAIFQRIVGIIKLTSGYCNGNTSNPTYQDICLGVTGHAEVVKIEFDEFKISFKVLLDIFFEIHNPT
    TLNQQGNDRGTQYRSAIFYINNKQQLQAINMINLMSDNIVTQVTKLDCFYPAEDYHQNYFNNNLSKPYCQMLIRPKLDKY
    FSQ

    >gi|148244748|ref|YP_001219442.1| thiol:disulfide interchange protein DsbE [Candidatus Vesicomyosocius okutanii HA]
    MKKFLPLILFFVLASFLYIGLGLDPTKLPSPLLGRAFPNLQVEDFNSAKIYAIQDKLQGKISLVNVWASWCVTCRVEHEI
    LMKIAKTNSLQILGINYKDTRKDGNIFLTRLGNPYDSIVFDQLGKLGLELGVYATPETFITDQQGIIRFKRIGELTPRIW
    ESKISPLIDELRNSMR

    >gi|148244776|ref|YP_001219470.1| thioredoxin [Candidatus Vesicomyosocius okutanii HA]
    MINHKKRKIFLQWLLVIIAIFSFRVYQQHDLSSGVIPSFNSKTLSNVVVSSHSNKPTLIHFWATWCRICQLENDNIQTIS
    SNYRVLNIAIQSGSDTDLKAYAKEHDMKIDNIINDKSSSLAKLLGVKATPTSFFISKDNQIKFSEVGYVSMLGYRLRLWW
    TSL

    >gi|148244807|ref|YP_001219501.1| thioredoxin [Candidatus Vesicomyosocius okutanii HA]
    MAVLELNLSNFDETIQSNDIVILDFWAPWCGPCKQFAPIYDEVSNKVDNVIFAKINTEDEQKLASNFQIRSIPTLMIFRE
    QIEVFSQPGAMSGSNLEDVITKAKAFDMNEMRKEIKKKK

    >gi|148244808|ref|YP_001219502.1| arsenate reductase [Candidatus Vesicomyosocius okutanii HA]
    MIKMYGIKNCDTIKKAKKFFINHQVDFEFIDFRDNPIDKTKLQTFVDKVTWENLINKRSTTYRNLNDEEKGNITLDLVLK
    NPTLIKRPILIIGDDIMVGFSEKNYLKL

    >gi|148244859|ref|YP_001219553.1| electron transport complex protein RnfE [Candidatus Vesicomyosocius okutanii HA]
    MCNYNKIIKNGLWNNNQALVAILGLCPLLAVTNNIVNAVGLGLATTFVLVMSNVTVSIFRHHISKEIRIPVFVLLIASFV
    TIVELIMQSYFYDLYLILGIFVPLIVTN
    CAILGRAEAFASKNTWDKSILDGLMMGIGFSVVLIILGAMRELIGNGTLFDK
    SVLLLGDFGNTLSITVFENYQGTLLAILPPGAFIGLGLIIAMKNKYDLKRKKL

    >gi|148244895|ref|YP_001219589.1| redox protein regulator [Candidatus Vesicomyosocius okutanii HA]
    MNTTVKWINDMMIVGESDSGHAIVMDGPQNLGGKNLGIRPMEMLLLGIGGCTTIDVISTLKKMCQEVHTFRAEISSERAK
    EHPKIFTKIHIHFAIKGVNLNDKKVSKAVNLSTNKYCSALIILGKSATITHDFKIHK

    >gi|148244929|ref|YP_001219623.1| intracellular sulfur oxidation protein DsrE [Candidatus Vesicomyosocius okutanii HA]
    MKISIQINEGPYQHQASDTAYQFAKAAIEKGHEIFRVFFYHDGVNNASRFTIPPQDDRNIVNQWAELGIKNANGEPELVV
    CVAAALRRGMLDESEASKNGIDGNNIHPAFRISGLGQLIEAGIQSDRLVVFGD

    >gi|148244973|ref|YP_001219667.1| rhodanese family protein [Candidatus Vesicomyosocius okutanii HA]
    MEIFEFLFANEQIFTTITLILLIALFIGNIVVDKLKKYKDIDPNGAVTLMDNNNLILLDVREERERKVGYIDGDIHIPLA
    NVKSKLLSLDKHKKVLVY
    CRSGSRSAHISGLLTRNKFVSVYNLKGGFQAWKRAKLPIKT

    >gi|148244974|ref|YP_001219668.1| glutaredoxin 3 [Candidatus Vesicomyosocius okutanii HA]
    MKKNIIYCSDSCFFCQKAYQLLEKKGIHFKKHYVRTQVDWNEVKEKTNRTTVPQIFINDFYIGGFDDLSAAEQSGKLDEI
    LNKT

    >gi|148244990|ref|YP_001219684.1| DsbA family thiol:disulfide interchange protein [Candidatus Vesicomyosocius okutanii HA]
    MKKILSILLIAFSSFVFSKDYEAGIDYIVLNKPVKTITGDKIEVRELFWYYCLHCYNLEPLINRWLKTKPSNVEFVRQTA
    IFSERWLNGAIFYFVLEELDLVEKLHEELFDVIHVNNKRFNSKESFVNWVASFGVNKNKIETAFNSFNVKIKVNRSKLNT
    LKYKITGVPAIIINGKYLTDATYAGSHIDMFKVVDFLIKKESKLE

    >gi|148244999|ref|YP_001219693.1| pyruvate dehydrogenase complex E3 component [Candidatus Vesicomyosocius okutanii HA]
    MIKTQIVIIGSGPGGYTAAFRLADLGKQVTLIERYNALGGVCLNVGCIPSKALLHTAQIINEAKDASHVGVTFNEPLISI
    NGIRTNKDNIVTKLTNGIKTLAKARKINVITGYGRFISANQITIENSDDIIEFEQCIIATGSQVTKIPTLPFDDARVMSS
    TDALNLSNIPKRLLVVGGGIIGLEMATVYNALGSEITVVELSDQLITSADKDIINPLLRRIKKQYANIFLNTKITKIEAL
    KEGIKVRFEGKNTPKFDTFDKILVAIGRTPNGRLIDCEKAGVEINDWGFIPVNKQMKTNVNNIYAIGDIIGQPMLAHKAI
    HEAKIAAEVICGYKSGFNALTIPSIAYTDPEIAWTGKTEKELKAEGISYEKGLFPWTNSGRSLSIGRSEGITKGLFDTKI
    GKILGMGICGTNASELIAEATLAIEMGCDMDDIALTIHAHPTLSETTAFATEMAQGTITDLLSSKKKK

    >gi|148245039|ref|YP_001219733.1| rhodanese family protein [Candidatus Vesicomyosocius okutanii HA]
    MLYNNFIIYIICLNTPGLTLKTNFGNYTMFNSFSSNDACQLLANGAQLVDVRSSNEFAQGALPNAINLPLQSIMTADRII
    DRNKAVILY
    CVTGIRSSTAKNYLIQMGYKNVNDLGSFKNYNCE

    >gi|148245041|ref|YP_001219735.1| thioredoxin [Candidatus Vesicomyosocius okutanii HA]
    MIAICLNCNRLNNIPKNKLKNKPNCGNCKNPIYSGQPINVSGIQLTRAIEKTDELLVVDFWATWCGPCKTFAPTFKQVTT
    QLEPKARFIKIETEKEQVISTKHNIRSIPTLAIFKDGKEIERISGSLSAPDFINWVNQYT

    >gi|148245042|ref|YP_001219736.1| rhodanese family protein [Candidatus Vesicomyosocius okutanii HA]
    MDRYQKLVAQALSSVIEIFSWDLEEEIQRNKDLILLDIREQDEFDMMHIKNSIHVPRGILESACVWNYDNTVPKLVQAIN
    QDIIVI
    CHSGNRSALATLTMQQMGFNKVRSLKMGIKGWNDNDLEMVNSNHVIVDINKADAWLNRAISEDKLESRKNNAN

    >gi|148245059|ref|YP_001219753.1| cation-transporting P-type ATPase [Candidatus Vesicomyosocius okutanii HA]
    MSNSCYHCGLEVIIRNQVRVPIEGKQQDFCCSGCASVCQTIYLSGLSSFYHQQTNSLLPAIDLEYPIEFYDAQAFQQPFL
    ESSYESGTKTITLISNTIH
    CAACVWLIERAINALNGVLWVRVNLTDKRIRLSWVDTDIQLSVIMQKLADLGYSAMPYEQD
    IAESVANKINRLILYRIGFSAFTMMNLLWISIALYTGATDGKYHHYFQWLSFVLATPTLFYAGMPFLKNAYFGLKNCFMN
    MDVPISIGALSTYFYSVYVLFGLSAKNEVYFDTVVNFIFVILIGRYLESSAKKSTLSASSALQQLQPKVAYVINKGEEQI
    TPVGIIKIGDTVLIKPAERIAVDGIVLSGNSEVDESLLTGESLLIRKQSSDEVFAGSINASGSLIIKVTKTLRNSALGQI
    VSLVETTKYNKSSIICMLDKIIPYFVGMTILLAIVTFIYWYPYDFDLALLSATSVLIITCPCAFGLATPMSVAVASGVAI
    KKKILIKNSDALEVLDKVDWVVFDKTGTLTRGKFSISHIETVIDKTIFINIMRSIERYSEHPLAKAIVDIDFASKYLAVS
    GFYADYGQGVSGIVDQQRYKIGNLSYVDVHHKVNTDLLNKSIILEEQGASCIWCATESEVLGFVILQDKIKLDAAKVVNQ
    LTSIGKQVSILSGDSKIVTQAIALELGIEHMISQALPKDKANYIKQLQQRHIVLMVGDGVNDAPALVQADVSIAIGSGSD
    VSVNSADLVILESTISPIIDLINLAKHTNSIIRQNIIFALLYNTFMIPLAMMSKVTPLFAAIVMPISSLIVIGNAARLRN
    K

    >gi|148245085|ref|YP_001219779.1| thiol:disulfide interchange protein DsbD [Candidatus Vesicomyosocius okutanii HA]
    MKRLLISLILILSTFLLAQVENDLLPVNKAFIFKAEVVNNKILLNWKIKKNYFLYKEKIKIYADFSAQLGNAKFPKTKIR
    NDEFFGKIGIYRDNTIVVVPILKGGAKSILLTVNYQGCSDLGVCYPPITKSVVLDISSIHSTSLDNNSFNLLSQATNKVQ
    SLVKNSIPTSNKPLSVDNAFKFSVVAINNNTLLAKWDIHQEYYLYHNKFLFDIKGATFGNIVISKGKIKDDKFLGKIEVH
    KDALEVEIPLTDINTKSITLIIKYQGCWEGGVCFSPQEKTINIMLPSQTNNPKINALSKKKSIYTPNIVQIELNETDQIT
    ALFQQENILLVLASFFGFGLLLSLTPCVFPMIPILSGIIVGQKEEVSTKKALIMSIVFVLSMSIAYSIVGVFAGYFGENL
    QVLFQDPWVLSIFSLIFVTLAFSMFGYYEIQLPTSLQEKITKINNDQKGGHLISVAIMGFLSALIIGPCVTPPLAGALIY
    IGQTGDALLGGISLFIMSLGMGSLLIIVGAGVSKLPKADGWMESIKYIFGILMLAIAIYLLDRIISPLTSLILWAMLITI
    SPIAMGALNTQINTSKPWQRIFKALGLIILGYGILLWILVARGGGDMLQPLSSWRSSNIEIESDHLKFKQIKSISDLEQV
    LIQTKNNNQIVMLDFYANW
    CTSCKELELFIFSNTHVVNEMSDVIALQADVTENNINDKALMKRFNIVGPPAILFFKNGIE
    NRSQRIIGEINTQNFLSRLNKIK

    >gi|148245090|ref|YP_001219784.1| iron-sulfur cluster insertion protein ErpA [Candidatus Vesicomyosocius okutanii HA]
    MEIKQISEKADIIFSDNAAKKVSTLIEEEQNNNLYLRVYITGGGCSGFSYGFTFDEKRKEGDSSVTNNGVQLVIDPMSYQ
    YLIGATVDYLEDLQGARFIIHNPNAKTTCGCGSSFSV

    >gi|148244901|ref|YP_001219595.1| hypothetical protein COSY_0764 [Candidatus Vesicomyosocius okutanii HA]
    MRFLLKGFRNGLGAIIAFISWIVPVSKVKRTSEQQHKVDKETINIELYQFFGCPFCIKTRRMIKRLNLHIITRNAQTIGS
    KFRDEIQRETGKVQVPCLKITNGDEVQWMFESNEISTYLNKHFR