Candidatus Solibacter usitatus Ellin6076 uid58139

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|116619151|ref|YP_821307.1| electron transport protein SCO1/SenC [Solibacter usitatus Ellin6076]
    MPNLLSTLVLFAHTYPVDGIVVAVDPQARTMLVSHRPIPHYMPAMMMPFRVENPAVLQPLHPGARITFDLAVTKSQALAR
    NVRATGDPDAALPAPPQKLAIGAPLPEFALTDQHGRTVTPADFRGQIVAIDFIYSR
    CPLPDVCPRLSANFAMLQRRFGAN
    ITLLSVTVDPDYDTPAVLADYARRWSAGPAWHFLTGDVAPLAAALGEIYWAGEGSIGHNSTTCIIDRTGRLAAVIEGSNY
    RPDQLVNLISRQLETHP

    >gi|116619270|ref|YP_821426.1| hypothetical protein Acid_0126 [Solibacter usitatus Ellin6076]
    MPRIVSLISSATEIVDALGQLLNLVGRSHECDYPEAVQALPVCTRPRIAVDASSAEIDRLVKQSARESISIYDVFDDVIE
    RLEPTHILTQIQCEV
    CAVSLRDVEAAMARGLKSRPKVVSLQPDSLTEIWNDIRRVAASLGIPQRGDALIADLQARMQLEL
    PADRPTVACIEWLEPLMAAGNWTPELIEMAGGRNLFGEAGRHSPWLTWEELTAADPDVIILAPCGFSLERTEQELYWMTD
    RPGWSTLRARVYLADGNQFFNRPGPRVVETQRILAEILHPEGFEPTLRGAGWRAL

    >gi|116619312|ref|YP_821468.1| methionine-R-sulfoxide reductase [Solibacter usitatus Ellin6076]
    MPVAFAGLMALWYRRERPLPNPRQPGSGRPIRVVLFLDNGKRGETIQVNKIAKTDADWQKELTPEEFAVTRKKGTERAFT
    GRYWDNHEPGLYRCTCCGTTLFRANEKFDSGTGWPSFYAPAAEENVATETDSSLFMKRTEVLCSKCDAHLGHVFDDGPAP
    TGLRY
    CINSAALKFTPEKEK

    >gi|116619449|ref|YP_821605.1| thioredoxin [Solibacter usitatus Ellin6076]
    MAGQNTLTFSDSTFDEDVLRSDVPVLVDFWAEWCGPCRQMSPTIDVVAGEYAGKVKVGKLDVDANGGTAMRYNVRGIPTL
    LLFKGGQVVEQRVGAIGKSDVLKMIDAHV

    >gi|116619550|ref|YP_821706.1| alkylhydroperoxidase [Solibacter usitatus Ellin6076]
    MELEQLLNSVPEYAKDLKLNMGGVLRQTELTEQQAWGTAVACAIAARNPQLRESVLGEAAKHLNEQALFAAKAAASVMGM
    NNIFYRFRHLSTNPKYGAMPARLRMQVIAKHGSDPIDFELWCLAVSAMNGCGV
    CVDSHENVLREKGVSEEAVLAAIRIAS
    TIHGLAAILDVEADPIA

    >gi|116619551|ref|YP_821707.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Solibacter usitatus Ellin6076]
    MLGVGQKFPAFSVQATVSLEKGKAFQTITDQNFKDKWKIYFFWPKDFTFVCPTEIAAFGKLNRDFQDRDAQVLGGSTDSE
    FVHHAWRTHHADLKDLPFPMLADVKRDLCEALGILDPQEGVAQRATFIVDPHDIIRFVSVNDLSVGRNPQEVLRVLDALQ
    TDELCPCNWQKGEEALTVAV

    >gi|116619598|ref|YP_821754.1| OsmC family protein [Solibacter usitatus Ellin6076]
    MDMEICIQHLGDVKFAATARGHRVVCDQPAANGGSDSGMTPPEFLLASLGTCAGFYAAQYLKNHKLSQAGLEVVVNAEKA
    AAPARLGKFQVDVFAPGLAPEHEAGMMRAVNACLIKNTLAMPPVIETALHTHEAATV

    >gi|116619661|ref|YP_821817.1| DSBA oxidoreductase [Solibacter usitatus Ellin6076]
    MKKFLGYATLLLVAAVPVTAQMANDQAGMTKQQADEMLKELRQIRLLLERQQAKPAAPQEEQPTRAKITDLSGVSMLGTK
    TAPLTIVEYTDYQ
    CPFCQRFHVTAFSELKKQYIDTGKVRFFSKDMPLDFHPNALRAAQAARCAAEQKKFWELRDVMGANP
    DKLDIDHIMNFAADLKMDTAALRACVDSGKYKDTVQRDVLEAMKIGANGTPTFIVGKSVGEGVDGELVVGAMPFEMFDAK
    LKSLEK

    >gi|116619727|ref|YP_821883.1| thioredoxin reductase [Solibacter usitatus Ellin6076]
    MRNVVIIGSGCAGNTAAIYTARANLKPLVIAGHEAGGQLSLTTLVENFPGFPEGINGPDLVENMRVQAQNFGAEFMHGSV
    IDTDFSQRPFRLNIEGDWMETRTVIIASGASARWLGLESEHKLIGHGVSS
    CATCDGFFYRGRKIMVVGGGDSAMEEANFL
    SRFGSEVTLVHRREEFRASKIMLDRAQHNPKIKFLLNTEVEEVHDVSKKLVTHVRLRNNKSGEVWDQEVDGFFLAIGHIP
    NTKVFKGQIETDPDGYILSKGGARTNIAGVFHAGDVQDRTYRQAITAAGAGCMAAIEVERFLEAEGH

    >gi|116619824|ref|YP_821980.1| thioredoxin [Solibacter usitatus Ellin6076]
    MAEADLIRCPACGATNRVPREKIAQGLQPVCGQCKAGLPVDSSPIVVTDKTFAAVVEQSAVPVLVDLWAPWCGPCRMVAP
    AVEALAAEMAGRLRVAKINVDDNPGVSSRFNVQSIPTLLLIRGGREVNRLVGAQPKQDIARWLARSLG

    >gi|116619877|ref|YP_822033.1| UBA/THIF-type NAD/FAD binding protein [Solibacter usitatus Ellin6076]
    MLPSQFMDRRDRDRYSRQILFPGIGERGQEALLAAHVVIAGCGALGSFHAAALARAGVGRLTLIDRDYIEPSNLHRQWLF
    EEEDAAEGLPKAAAAARRLGRINSSIQVHPAIADLTAGNAEELLGEADVILDGTDNFETRYLINDFAVSRGIPWVYGAAV
    GSYGLTMPVIPGQSACLRCVYPEPPGTGQPT
    CETAGVLNVIVSAVASIQVADTLRLLTGAPLRARITTFDVWKGGIRQID
    APDRDPDCPTCARREFPCLVETQRQPATLCGRNAVQISGVERPLDLAELKARLEPLGTVRANEYALRFQTDAYELTVFAD
    GRAIVKGTGDTGIARSLYARYVG

    >gi|116619883|ref|YP_822039.1| UBA/THIF-type NAD/FAD binding protein [Solibacter usitatus Ellin6076]
    MTTAPPVTLSKDEILRYSRHLIIPEVGIEGQQKLKAAKVLLVGTGGLGAPLGLYLAAAGIGKIGLVDFDVVDFTNLQRQV
    IHFTQDVGRNKIDSASEKMLALNPHVEIVKHEVALSSENALDILKDYDLVVDGTDNFPTRYLVNDACVLLGKPNVYGSIF
    RFEGQATVFAYEGGPCYRCLYPEPPPPGLVPS
    CAEGGVLGILPGTIGLIQATETVKLILGIGEPLVGRLLLYDALGMRFR
    ELRLRKNPECPVCGDHRTITKLIDYQQFCGIPQQAPKQEEKVAEGEIEVTEVKKMLDRGDNFVLIDVREPHEYQICSIPG
    SKLIPLGEVGKRLDELDPNADIVVH
    CKSGMRSARACGVLRANGFQHVRNMKGGILAWSDQVDPSVPKY

    >gi|116620040|ref|YP_822196.1| dihydrolipoamide dehydrogenase [Solibacter usitatus Ellin6076]
    MPYDLIVIGSGPGGYSAAIRAGQYGLKTALIEKQPRLGGTCLLVGCIPTKSLLHTADVWDHFVHAEADGIVAENPRLDFP
    KVQARKDGIVSKHSKGVEFLLKRAKVERISGYATIKGGGKIEVKTDAGVQTLEARNIIIATGSEARMLPGMQPDPEFILT
    NIEILNLAAVPKSLIIIGAGAVGVEFASIFKRFGTDVTVIEMLPRIVPVEDEDISKELERVFKKQKIRVETGARAENIQK
    TGTGVKLTLTTKDGKQEQLEAEKLLVAVGRKPNTDAIGLENTKVQLDRGFIKVDQYQQTGEPGVYAIGDVVAGTPQLAHV
    ATREGMIAVAHMAGKPAVPINKNRIPGATYTTPGIGSVGLTEAQARAQGYQVKVGKFPFAGDSRATILGQHEGFIKVVAD
    EKYGEILGVHIIGPDGFELIAEAVAAMEAEATVDVMMQTIHAHPTLYEAVGEAFNAVYGLSINA

    >gi|116620198|ref|YP_822354.1| soluble pyridine nucleotide transhydrogenase [Solibacter usitatus Ellin6076]
    MQKFDIIVIGSGPAGQRAAIQGAKCGRRVAVIEQREIVGGACVNTGTIPSKTMREAVMHLSGFQYQGIYGSNYHVKEKIL
    MADLGFRVKQVIKTEVDVTQAQLTRNGVEVITGRAGFLDSTHVRVESSRGQTDLEAPIIIIATGTKPSTSPTVPLNGRTI
    VNSDQILDIPEIPKTLIVVGGGVIGVEYTCIFAILGVRVILIEKRPRLLEFADSEMVEALSYHLRDHRVTMRLNEEVAAV
    EEQAGGGVVARLKSNKVISGDALLYAVGRQGNVEDLNLPAAGLEADGRGRITVDSDYRTKTSNIYAAGDVIGFPSLASVS
    MEQGRLAAANAVGLKIQSNPATYPYGIYTIPEISFVGKTEEQLTADDVPYEVGVAYYRETARGQIRGDTTGRLKLIFHRE
    TREILGVHIIGEGATELLHIGQAVMILKGTVDYFVETVFNYPTLAECYKQAAFNGINKLMRF

    >gi|116620241|ref|YP_822397.1| redoxin domain-containing protein [Solibacter usitatus Ellin6076]
    MFRIAVLLVCALPLSAFQGADSTVFAKLGHSQHGEAFDSGPREKPWPIPGIGVAHFPITTKNPEVQQWFDQGNALLHSFW
    DYEAERSFRWCLKLEPDNAMAYWGLARASMLRGSGGRDRPADMIREALKRKDHASPRERLYIDALAAEILPDPLREGSKE
    RERGRKILETLCVQYPEDMEARALLALNTLGDDRYGAELMIREILAKQPDHPGAHHYRIHNWDYHEPEQALDSARRYGEI
    VPGIGHALHMPGHIFSIVGMWNEAAISMDAATRREKQYMKERLTFPFNNWNYGHNLNYLSYIYEQLGMAQAATFASRQLI
    DAPLDPQGNDDSLFSTHSYGIAALGRVLLKYERWDDLLKEGNIPWRDIFADKVNKEYFEARAHFGKGEIGKAEKNLAAHT
    ALKKDLEKNKSGPIADVYEIQAQDLRGRLALSRGETLEGLKFLSEAAQKEFDLQRSYADPPVYPEALYNSLGEAYLATKS
    PLLAAIAFEKALTLTHNDLFALSGLVRAYAAAGEKAKAEDAMARLLFVTADADKGLAIVSRATATGITATPRDSSPRPQR
    NYLRTSLEQFGPNRWEPYAAPLLDVKDASGKRVTLDEYKGKNVILVFYLGAE
    CPHCMRQLHDIGGKKSEWERLNTVVLAV
    SSTPPDKNSKALKEFGDLPIRLLSDDHQANAHRFHSYDDFEDAELHSTILIDREGRVRWARNGGDPFSDMAFLVKQVEAM
    KTPLAQP

    >gi|116620371|ref|YP_822527.1| hypothetical protein Acid_1248 [Solibacter usitatus Ellin6076]
    MTHAAQFLVHYGYVLLFGWLLLEQGALPLPSIPLLLACGALARSGQLHPLLVVASGLAACLIADNVWFQLGRRKGGKVLH
    FLCRIALEPDSCVRQTENAFQRYGVHSLLVSKFIPGLNAVAAPLAGSSGTGMARFLIFDTAGALLWILAYTGLGYVFSDQ
    IEIVGAYAVRTGSGLAIVTVAVVAGWVAWKYIQRQRFLKKIKVARITPQELREKLDAGEDVFVIDLRSEREFEEDAIPGA
    MHMPANQLAERNSAIPRDRDVILF
    CS

    >gi|116620381|ref|YP_822537.1| methylated-DNA--protein-cysteine methyltransferase [Solibacter usitatus Ellin6076]
    MIEWTEICLTDDLTVRLVTSKLGLRAINFRLSEPVEGERNDSNPIARETARQLAAYFDGRLRSFDLALDLQGTAFQTRVW
    RELERIPYGKTRSYLQIAEAIASPKAVRAVGAANGANPIPIVIP
    CHRVIGSTGRLVGYGGGLPLKKRLLTLEGALALDLR
    W

    >gi|116620462|ref|YP_822618.1| alkylhydroperoxidase [Solibacter usitatus Ellin6076]
    MATFGFIEYADAAPEVRAVYDDIMATRQTDWINNFWKALAHDPATLRRTWESIKQIMAPGALDPLLKEMIYVAVSATNQC
    GY
    CIASHTASARKAGMTAEMFAELMAVVGMANETNRLASGYQVEIDERFKV

    >gi|116620503|ref|YP_822659.1| OsmC family protein [Solibacter usitatus Ellin6076]
    MITAASNPTNYTTVFTDGVHSSVSDDTLHNGGSGQGFRPHDLLEAAIATCINIAVRTCAAREGMPLSGVVTKVSLDRSEP
    DEAVFHHEVELRGELTPQQRSRLLRVANA
    CPVRRTLMRTIRFEDGQIA

    >gi|116620572|ref|YP_822728.1| redoxin domain-containing protein [Solibacter usitatus Ellin6076]
    MRSPLGIGFVWIAIQLYAAAPDNVEQATARFERSLAKVPEPLRSGFRALAEKALQRHRPLLAQTFSEQPAPAKPAGPRVD
    PASTPAGAAITRKLDQLTHIPNDADRAKFAIGLASDIRALPAGFGKVLLAWNLRVETTYEGDLGQDALVAVAGTYADALK
    GCPSADMYVDFAGLVRYEHVRATVEDSALDAALALLELRERIHEEGDFSLAALDGKGYSLSGLRGKVVLLNFWATS
    CAPC
    RKEMQDMEKLYREFSGKGLVVLAVSDDKRETIDKFVANKRYTFPILLDPERKAYGDFDIEGIPKTFVFDREGALAAQAID
    MRTEAQFRSMLKAAGLE

    >gi|116620575|ref|YP_822731.1| DSBA oxidoreductase [Solibacter usitatus Ellin6076]
    MFRATLLSLISVLLLSAADAPPKSAFDKPTLEAYVRHLYLLNPQLTVTVNDPKPSALPGFKEVKLRIAQGAQFQDLTLYV
    SNDGKKIVQGNFYDVTTNPFKPEIDKLKTQFQPALGTPGAPVQIVAFSDLQ
    CPHCKTEAQMLRENLIKNYPKEVRLYFKD
    FPLEGLHPWAKAAAMAGRCVFQQNADAFWDYHDFVFSKQESLTPENLKDQILAWAKDNKSLDSVKLGACIDSKATQAEVE
    KEMEDGRALDISSTPTLFINGRRIGQSIDWANLKTIIDSEIEYQKTAKNAGDDCGCEVKLDVPGMPSATPAIAPVKKK

    >gi|116620596|ref|YP_822752.1| redoxin domain-containing protein [Solibacter usitatus Ellin6076]
    MRAMHKLRATAALTLLSIVAPLARAAVVPRPAPELAINLGQGKQIKLSQYKGKPVVIAFILTYCSHCQKVMGALAKMHNE
    FGPGGLQVLASATEDMAASALPGFLRQYAPPFLVGYNSNLETVSFLQHSSMLMLYMPGLVFIDKDGMIRAQYEGKDPFLE
    ETSAEKNIRAELEKLMGQPSVKKSPKSRKK

    >gi|116620608|ref|YP_822764.1| redoxin domain-containing protein [Solibacter usitatus Ellin6076]
    MKKLAIALLCAMALTGADAPRRAPGFCLPDQTMQWRDLADYRGKVVVLEFMQSTCPHCAAFVPVLTSLQQKYAGRLQVIS
    VAVAPDPPQAVVQFATGHKLTYPLLYDSGQMTMSYVRAQGVDFPTVYLIDAAGMIRGSWANGPMTKDFFEGNGITREVDK
    LMAGAPAAAGKK

    >gi|116620680|ref|YP_822836.1| redoxin domain-containing protein [Solibacter usitatus Ellin6076]
    MARSKPAESRLQAGLPAPQGEAPSFRRVRANRCTVIQGEPQMMRANKRSVIPILLLLALTAYGQQPSLINAVRTLIAGHD
    VPAAERLARSYQARTGPTPELAAAFSWIARAQFDAKNYDQADALAQETTKIASRFLMGQKLDDDPWLPTAQGAAIEVHAQ
    VLAARGERAEALEYLRGQLKQFTGTSLAERIRKNINLLSLEGKPAPPLEEKEWLGPKPPSLAALRGHPVLLFFWAHW
    CSD
    CKAEIGIIANLRRTFAPQGLAVIGPTRLYGYVAGGEDAPAEKEKLYIEQVRKRFYADLLDMPAPLSAANFVAYGASSTPT
    LVLIDGGGIVRYYHPGNASEAELTARIRAALRK

    >gi|116620682|ref|YP_822838.1| redoxin domain-containing protein [Solibacter usitatus Ellin6076]
    MLLSVVLVFFIYSGIHERVVVAGDSAPEFTIHTDNGRTVTLPNFGGKLLVLNFWATWCPPCVQETPSLSQFAATYAGKGV
    VVLGVSVDRDEKAYRAFLQKFNPAFLTAREGKLHEDYGTFMYPETYIIDSKGKVLEKLAEPADWMDPKMTQLIDRLL

    >gi|116621077|ref|YP_823233.1| electron transport protein SCO1/SenC [Solibacter usitatus Ellin6076]
    MGNSLSGRIGVCRRLAPFLIGVSLAAATRYPVTGVVLKVDPPHRSFEASCAAIPGYMEAMAMAYSVVDNRELADLKPGAY
    VDFTLVVDKKRSYAERIRIHHYESAEREPMLARRLKLLEAPHATVQPGDAVPDFTLTDQTGRRVTLSQWAGKVVGVTFIY
    TS
    CPLPDYCFRLANNFGQLNQRFASRMGRDLVLLSISFDPVHDQPAVLAKYASTWKADPESWYFLTGPLDDVKAVSRQFG
    LNFWPDEAYLTHSLHTLVIDRRGRLAADFEGNQFTARQLGDYVEALISGR

    >gi|116621401|ref|YP_823557.1| redoxin domain-containing protein [Solibacter usitatus Ellin6076]
    MKSRLVLTTLAFAGAICAADTTVAQTAAKLEEQLTTAPGSIGAEYRLGAAQALQAGYPELSRRFLETALKSLRGSKDVPE
    PAVWQALAEMAPAEAAALAPQFGSGGTLLAITTLVREGHADEAAALYRKTAASFAEPLSFADANWLVNASGPLAKTLPDA
    VADNYERAIRAASASPDFGGDVKMTRTIQVGTTSITTDNARDTLLILAGARLRLLSPERFAKYRETFSKWNLTGPATVRS
    AGAPASPEVASISNRMGTMRKLPSDRDRTQLVKELVPEIRKLPLQWRLGLIRGLAGVATEGDLGKEALGMVAVTLADTLR
    EASQGPGSYGDSYLGLAKMVRYEHLTVPTDPTLAAAQALLALREQVQQENGFSLTSLDGKTYTLAGLKGKIVLLNFWATW
    CPPCRKEMPDMEKLYRTYEKQGLTVIAVSDEDRETVANFLAKNNYSFPIALDAGRKVNSAFLVEGIPQSFIFDREGRLAA
    QAIDMRTEGQFMELLRRAGLE

    >gi|116621490|ref|YP_823646.1| redoxin domain-containing protein [Solibacter usitatus Ellin6076]
    MLRNLLVAFFFVTSLPQFQLRDTQGGLHTPAEWAKQKAVVLFFITTDCPVGNSYVPEMNRLREAYGARGVGFYAVQADPT
    VANDVVARYARDYRYSFPLLLDPTQILVRHANAAITPQAAILAPDGKVVYLGPIDNRVEDFGKSRPQATEAYVRLVLDSM
    LSGKGVIFGTHKSIGCSITRVKQ

    >gi|116621545|ref|YP_823701.1| hypothetical protein Acid_2427 [Solibacter usitatus Ellin6076]
    MKHTEKLAPLAAVASAISCMACCLPFGIAAAAGSAGLGMVLEPFRPYLMALSAGLLLFGLWQLYRKGRTCERRSRTSVAI
    FWACAVIVLTMVLAPQFLANLLADL

    >gi|116621775|ref|YP_823931.1| redoxin domain-containing protein [Solibacter usitatus Ellin6076]
    MNKLMRTLALIMIGCLAAAAAEIPRPAPELAVQGPGGKPLRLSQFRGKVVVLTLMHTTCQHCQDLTRLLVPIQKDYQARN
    VVVFEVAFNEDAPMTMGPFYKVFEPNFPVGLTNDAAVRQFLKWNDKTDGPLMVPHMTFIDAKGNIVYDHGDNDFFGASLD
    KNIRGLIDKMVAKAPAAATSAAKKK

    >gi|116621925|ref|YP_824081.1| alkylhydroperoxidase [Solibacter usitatus Ellin6076]
    MATAINRVDPAENEFLASLEAKSKQANSFLRAMANRPEALKSFVPFYGAIVGPGSVERRIKSMMYLAASFANQCAFCIAS
    NLPGARKSGLTEAEIQALQNGQDESFSEAERAAIRYARELTRSAQPGDTREQMFLHFTHEQIVEITLVIAMANFTNRFNN
    GLAILPEA

    >gi|116622232|ref|YP_824388.1| redoxin domain-containing protein [Solibacter usitatus Ellin6076]
    MLNRHTAVLSLALVLSCAALRAQDEVAHPAAGAPPILPVGSPAPDFNLPGIDGKLHNLAEYRASKVLVVVFTCDHCPVAQ
    MYEKRIKELTADYRDRGVAVVAINPNDPNAVRYSEMGHTDVGDTLAEMKIRAEYRHFNFPYLSDGATQAVSLKYGPTATP
    HAFIFDEKRILRYQGRIDSSQREELVTRHETRDAIEALLGGKPVAVQNTPAVGCSTKWSEKKTGAAAEVAATEKANVALE
    AVNLDQLRALRKNGTGKFLLINFWATW
    CEPCVAEFPELQRELAMYRKRPFDVVTVSINTPDERSGVLSFLKELHAGTRNL
    LFDFNDPADGIAAFGTNWAGGVPYTVLLSPEGEIVYRVQGAINPFEVRRTILKYLPDDHYIGTHAYWNSVF

    >gi|116622589|ref|YP_824745.1| redoxin domain-containing protein [Solibacter usitatus Ellin6076]
    MRLVALTLLVAAVAICAEAPKADLTLQDSAGKKVRLRDLRGKPAVLNFWATWCGPCKAEMPMLVELEKQYAARGVQFIGA
    SMDGSKTKAQIPSFLAEHHVAFPVWYGGSADDLDRLHLGGAVPATAFLDAEGHIVARILGQARLEELKERLDWLTGDRSG
    PAPEPLVKHLQ

    >gi|116622595|ref|YP_824751.1| TPR repeat-containing protein [Solibacter usitatus Ellin6076]
    MPIRLWFALSIATLTGYAQPAGCAMDRAVRLHQTGDFPGAIREYQACIAAEPARVEARSNLGAVLAKLGRYQDAIDQYQA
    ALRMAPRDLASRLRFNLALAYYKSFQIPEAVAEFETLRGEQPADLNLALLLADCRLRTGDFQAAIDVLTPLEASQPDQPA
    LDYVLGMALLRTGRIPEGQARVDRILRRGESAEGRFLLGASLFMAGNFPGAVAEFSKAAALDPNLPSLQSYYGQALLFTG
    DADGAAVAFRKELAANPNDFDANFQLASILAHRGKPDEARPLLARAVQVRPGSAEAREALGKGFPADQPTQADPGIAVGS
    RAPAIGTLDLGRPTKPVVLVFGSYT
    CPKLRSSAAALKRIAEQYRDRIDFRLVYIREAHAQGGPESQWQSTINIKEGVSLA
    PARTLPEKQEHAALCLRKLELPFPAVIDGMDGAAETAYQAWPSRLYLVGRDGKVAFSTRLGELEFRPADLETAIREILSK
    TGVE

    >gi|116622615|ref|YP_824771.1| heavy metal translocating P-type ATPase [Solibacter usitatus Ellin6076]
    MSSCTLCGLPAGRNPLINGDQAFCCLGCLNVYSILGESGVLASGIDFRDTDLFRESLRLGLISTGAERVKPTIPDTAEQV
    ETVYHVSGMW
    CASCAWLIERALQSERGIRSAEVMFSSDLVKVRYCPQYIPPARITERIAALGYRASEYSGASESDHAERK
    AMLLRIGVAGFLWLNVMMLSLVIYASYWEAISDNARRVIPFVLMALTTPAVFYSAWPILRAAAIGLRHFTVRMEALLAVG
    ITAAYTYSAVQAFTGGKHYYFDTACAIITLVLLGKLLERGAKERTAKAISLLYRMMPKKARLLIDGRETFVSIEALQSGM
    TFLVKAGERIPADGVVLDGISHADESVITGESAPVAKQPGDPVICGSLNTGGVLEIRATRTGAASTLSQIIRSVESAMSS
    RSELERTVDRASRAFAPAVIAIALGTFSVCSLAGMDSATALMRAIAVLVIACPCALGMATPLAITAAVGAASRRGILVSD
    SRVLETVRKIDVAILDKTGTLTEGDFRVVATFPADSSPFLAAVSSIEQYSEHPLGRAITRRAAELGLTPHPARDIVIHKG
    LGISGVTAGSRVWVGNRRLMEECVGPIAPALAAASSAWQHDGHTVAFFAFDGKVAGAIAMGDAIRADAVRLVAELKRRGI
    HTALISGDAHSTTAAMAAAAGIAEFQAEVLPDDKLACVRRYQSAGKIVAMLGDGVNDAPALAGADLGIALGTGTDLAMQA
    APVVLMTPALDRVLEVFDIGRDTWRVVRQNLFWAFFYNAVGITLAVAGVLTPILAAAAMVLSSLSVIANSLRLSAMWDRH
    PGDVTQRAAAVRERYPHAIERNAP

    >gi|116622686|ref|YP_824842.1| hypothetical protein Acid_3585 [Solibacter usitatus Ellin6076]
    MCSRIVEMGENFTGVKNQKLTRLAGLLFAAVAIAAAAGMALIQPAELAPKLNSKGDRPVILYTGPNVLYRSKHIPGSVFV
    GPGSNAAGLALLRSEAAKIPKDREIVIYCGCCPWDR
    CPNVQPAIDALKEMGFAKVKALYLPTGFKVDWIDKGYPAE

    >gi|116622700|ref|YP_824856.1| redoxin domain-containing protein [Solibacter usitatus Ellin6076]
    MHTGLLRTLILSVALGARIAAAAEAPQVGQAAPGFSLPSQEGSTVSLKQFQGKWVVLYFYPKDMTQGCTIEAHNFQQDLA
    KYDKANAVIVGVSVDSTDSHKEFCTKESLTFKLLSDTDKKVVDQYGSLSPRGVASRNTFLIDPSGKISKVWIGVSPAKHS
    EEVLAALGSK

    >gi|116622720|ref|YP_824876.1| DSBA oxidoreductase [Solibacter usitatus Ellin6076]
    MRVASWKWVVGIVLGSAAILLAQEWQSVANLAGVDFAGLSAAKKNTALHALRNYDCTCGCGMKVAECRVKDPSCSYSRAL
    SGTLVDAIRKGKTEAAAVEEAKASKHGHVAEAKLLDDPVAIPTLGSPMIGPANARIVLVEFSDFQ
    CPYCVKAVAKINAIL
    QAYPNDVRLIFKQFPLETHPQASISAAAALAAHNQGKFWAMHDTLFANRTQLSRQNILGWAAKLGLDMKRFTADLDSDAI
    KKAVIKDTQDGDKAGVEGTPTVFIDGQRYNGELALDAVKPVIDGELKRLSAKK

    >gi|116622977|ref|YP_825133.1| redoxin domain-containing protein [Solibacter usitatus Ellin6076]
    MAFRKQTPLPAPGTLAPGFRLAALDGGEVTLTELTEHGPVLLAFFKISCPVCQLTMPYLERLHRQGGLRVYGISQNDAED
    TREFNRHFGVTFPTLLDSEDSGFPASNAYALSSVPTMFLVSADGTLERVIEGWNRIDMAALGDRAGMILFHAQDNVPAWK
    AG

    >gi|116622980|ref|YP_825136.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Solibacter usitatus Ellin6076]
    MALVVIGGTAAGMSAAARARRIDPRLEIIVLEKGPVISLGACGLPYFVEGKIREAKDLTVFTPERFRKERNVDVRTGARV
    ISIAHPRREVLLESGARVAYEKLVIATGARSESLGIAGDTQEHVFHMQTLEDAQRMRGFVRERKPKRAVVVGAGYIGVEA
    ADALRRNGLQVTILEFSPYALLRADDAFTAEVRKQLERHRVELKTGVRVTAIEPDSIAGVPCDMVVIAAGFRPAATLAAD
    AGVELGRSGAIRTDDRMETNVRGIFAAGDCAEVQHLVSGRPTWIPLGTTANKCGRVAGANAAGARERFPGIVGTSIVGIF
    GMGFATTGFSAAEARAEGFTPVTARIEALSRPRYYQGVKTIVELVADKATRRLLGGSIIGEDGTAGRINVLATALTARLR
    VDDFEQLDLAYSPPFAPVWDPVLIAAQQLIKEL

    >gi|116622983|ref|YP_825139.1| OsmC family protein [Solibacter usitatus Ellin6076]
    MKRTANAHWRGDLKTGKGDISTASGVLTSTPYSFQTRFEEGKGTNPEELLAAAHAGCFTMALSAQLAGAGLTAESLQTEC
    TISLEKLPDGFAITESHLDLKAKVPGASQEAFATAVHNAETG
    CPVSKLYKTKITVAYKLEN

    >gi|116623098|ref|YP_825254.1| methylated-DNA--protein-cysteine methyltransferase [Solibacter usitatus Ellin6076]
    MRDVLQLSIDRVETPIGELLLVADHDGSLRAVDWADYEARMLRLLGIHYRKNGFRLQPARNPHGLRDAITSYFGGELAAI
    DDLPVRTAGTDFQRSVWSALRKIPCGAPTSYGKLAEAIDRPTAVRAVGLANGSNPIGIVVP
    CHRVIGAKGSLTGYGGGLE
    RKRWLLEHEGMHGI

    >gi|116623105|ref|YP_825261.1| DNA-O6-methylguanine--protein-cysteine S-methyltransferase / transcriptional regulator Ada [Solibacter usitatus Ellin6076]
    MEVAMDETVKTDAQRWAAILRRDPAADGEFFYSVKTTGVYCRPSCASRLALRKNVVFHATTEAAERAGFRPCKRCKPDQA
    ALAEQHAAAIAAACRTIEVSETTPSLDELAAVAGMSRFYFHRTFKAITGVTPKAYASARRAERVRTELAASPTVTQAIYD
    AGFNSSGRFYEQSTDILGMTPGDFRAGGSRAAIRFAVAECSLGSILVAATEKGVCAILMGDDPETLVRDLQDRFPRAELT
    GGDREFEATVAKVLTFVEAPGLGLDLPLDVRGTAFQQRVWQALRAIPAGATASYAEIAARIGAPKSVRAVAQACAANSLA
    IAIP
    CHRVVRHDGGLSGYRWGVERKRALLTREGAR

    >gi|116623221|ref|YP_825377.1| redoxin domain-containing protein [Solibacter usitatus Ellin6076]
    MRTLRLILLTACCWTAVAADAPRPSPPFTIERTTGPALNLRQYRGKVVALAFIQTTCPHCQALTTELNLIAHDYAARGVQ
    FLECAFNPDATATMPGFLEHFKPSFPVGFSNQVAVMSYLQHSVLDPHPLYVPHMVFLDRAGVIRADYPGESDFFRNAGPN
    IRAELDKLLKAPAAHQ

    >gi|116623293|ref|YP_825449.1| iron-sulfur cluster assembly accessory protein [Solibacter usitatus Ellin6076]
    MVQITDRAVGKVREIMASQEPAPAGLRIAVVGGGCSGFSYSMAFENQPNVLDKTYNYEGLKIFVDQASLLYLDGAEVDYV
    ETLEGSGFKFNNPQVKSTCGCGSSFQV

    >gi|116623321|ref|YP_825477.1| mercuric reductase [Solibacter usitatus Ellin6076]
    MATQFDAIVIGTGQAGPSLARRLAATGRKVAVIERKLFGGTCVNTGCIPTKTMVASAYAAQMVRRAAEFGVDVPAPTIDM
    KRVKARKDAVSAASRVGLENSLKHLENCTVYEGHARFESPVEISVGADRLSAPWMFINVGGRAIVPAMPGVDAIDHLTNS
    SMMAVDFLPKHLIVVGGSYIGLEFGQMFRRFGSRVTILEMSPRLVHREDEDVSIAMREILEREGIEVRLNAKCIAFSRSG
    NDLIAHAECAEGSPDIAGSHVLLAVGRRPNTDDLGLEKAGVAVDGHGYITVDDELRTNVPGIWAMGDCNGKGAFTHTSYN
    DYEIVAANLLDNDPRRVSDRIACYALYTDPPLGRAGMTEAEARKTGRPLLIGKRPMTRVARAVEKGEQQGFMKVVIDKES
    KKILGAAILGTGGDEVVHSILDIMYAKAPYTVIQRAVHIHPTVSELIPTLLGELEG

    >gi|116623500|ref|YP_825656.1| arsenite S-adenosylmethyltransferase [Solibacter usitatus Ellin6076]
    MATQNITDVVKEKYGQAALRVVAGGSSSCCGAAPSNQCGDPITDNLYGAEVSELPADAIAASLGCGNPTALAQLNPGETV
    LDLGSGGGIDVLLSARRVGPTGKAYGLDMTDEMLALANANKAKAGLENVEFLKGQIESIPLPDNSVDVIISNCVINLSAN
    KDRVLAEAFRVLKPGGRFAVSDVVTHGEIPAEIREHVLLWVG
    CLAGALEDTDYQAKLAAAGFEAVGVEPTRVYRVDDARA
    FLSGKGLDVDAVAPLVDGKFFSAFIRARKPAAACCGPACCS

    >gi|116623604|ref|YP_825760.1| peptide methionine sulfoxide reductase [Solibacter usitatus Ellin6076]
    METITLGGGCFWCLEAVYVEMEGVQSVVSGYMGGHLADPDYRAVCTGSTGHIEVVQVTYDPAVTSTREILEVFFAIHDPT
    SLDRQGNDAGTQYRSAIFYHTQEQYEISQALIDELEREKIWSRPIVTEVRPAVKFYPAEDYHQNYFANNPQQPYCSFVVS
    PKVRKFREKFAAKMRKRA

    >gi|116623613|ref|YP_825769.1| twin-arginine translocation pathway signal [Solibacter usitatus Ellin6076]
    MPNCKSKRTIDFMKLLALAVAALIPCIAASPDVDKNKTMGNPNAPLMFELYSDFMCPHCKVMHETILPSIVQDYVKSGKA
    YLIFREFPLQIPQHVYSRAAAALAVAAGRVGKYQAVNDALFKTQNSWGQTGRLWEAVAPVLTPDEQKKVQALANDPSVLA
    EVQGDVDRGMKAQVNETPTLMITYKMKQQPWAKWADYSFFKSYVDGLLKN

    >gi|116623614|ref|YP_825770.1| protein-disulfide isomerase-like protein [Solibacter usitatus Ellin6076]
    MKMFALALAMTLASAAAGPEIEKSRTMGNPSAPLRMDLYSDFTCPHCKMLHEQILPKLVADYVSTGKAYLVFHEYTLTGP
    GHEHSKTASLYADAAAKIGKYQQVSDALFATQSSWALNGKVWEAVAPALTEPERKRVQLLFKDPAVAADVQRDLNMGTAS
    RVDRTPTLIITHKGKQTPWSWWENYGLFKSLVDAELQK

    >gi|116624011|ref|YP_826167.1| rhodanese domain-containing protein [Solibacter usitatus Ellin6076]
    MNSVKSATPAEIKQRLAAGEPLELIDVREPGELAIAAIEGARALPMSQASTWIDHLPGDRELVIICHHGMRSMQVAMALV
    QRGHGNVTNMTGGIDLWSTQVDPTVPRY

    >gi|116624029|ref|YP_826185.1| redoxin domain-containing protein [Solibacter usitatus Ellin6076]
    MLSWLFSDPLPVGTAAPDFTALDDGGRTVTLSKLRGRNVVLVFYPADDTPGCTKQLCQFRDDWSQATARNVAVYGVNPQS
    AGHHQKFRKKFSFPFPLLVDANQKIAQLYHAHGLIVKRTVYLIGPDGTVLFSQRGMPSPAEVLASAHIGVS

    >gi|116624276|ref|YP_826432.1| OsmC family protein [Solibacter usitatus Ellin6076]
    MTSSTEHIKAVLDRNAKALALRPSVGQGTAVTKVRLTEGLACQIEEGAWKLTADMSEKSGGTNTGPNPGILGRASLGSCL
    AIGYAMWAARRGVPIRSLEVEVQADYDTRAEFGIDGVKPGYGQVRCVVHVESDAPEEDVRRVFEQADAASSYLHVWQDAQ
    DVRVDIRVKGRV

    >gi|116624383|ref|YP_826539.1| redoxin domain-containing protein [Solibacter usitatus Ellin6076]
    MQEVAAKYPGKVTFVSENFGGSKLADKFGVKGYPAVFVDGVLVASPREFGFFGEVEGAGRYAPWRNAASQAKFKDDLRRM
    IDLILAGRKEQVTREHPADASAPRELATLPALSLTDLSGRPIARDELAGHVVLVEFWATW
    CPPCRSTLEWLGTLKGKYGD
    KLAILALAVESPEAGVRSMAAALDPAVRWAITDAATSQAFGDITAVPTLFVFDPTGKTARVLYGAPPDLHDQVTKLLDGL
    VR

    >gi|116624459|ref|YP_826615.1| redoxin domain-containing protein [Solibacter usitatus Ellin6076]
    MSASRFLTVFAAALVSACLITGCSSGPRTVKAASVKADKDRHPAPEFALKDSNGKTVRLEDYRGKVVLLDFFATWCGPCK
    IEIPWFMEMERKNKDRGFAVLGVSMDDEGWDIVKPFLAELGVNYRVVIGNDSTAQLYGGVDALPTTFLIDRNGKIASVHI
    GLASRKDFEDGIEQLLQAPKADASRTGGMVVPAFALGAK

    >gi|116624599|ref|YP_826755.1| DSBA oxidoreductase [Solibacter usitatus Ellin6076]
    MPSSPVVFSVLGAVAALAVTAVRAQEVDKAAMVNGAPILASEIDAKLGNDLAQLQQQIFNLRKKQLNTVIDQKLLEDESA
    RRGVMIAELVQSEVTSHVTPATSAEAEKFFKENSTKLKGDFKSLEEQIRNFLTAQRLQARQQEFLKSLRTAAKVEVFLAP
    PPVFRSEVSVEGAPSRGGVAAPVTIVEFSDFH
    CPFCRKAQSVLDNLRAKYGEKIRFVYRDFPLEGLHPQARVAAEASRCA
    AEQGKFWEFHDRLFHGDPDASQAALSRIAKESGMDLTAFEACRTSGKYKNSVQASAQEGARLGITGTPTFFVNGRMLVGS
    QSLDEFVSIIDEELAAGAGR

    >gi|116624684|ref|YP_826840.1| heavy metal transport/detoxification protein [Solibacter usitatus Ellin6076]
    MATETLKMTVHGMTCGNCARSVERKLTAIPGVSKATVDLLNQNATIDYDAAAVQPEALAAAVRQLGFEVPV

    >gi|116624685|ref|YP_826841.1| heavy metal translocating P-type ATPase [Solibacter usitatus Ellin6076]
    MKTSAPERIDLPVSGMTCAACARSIERTLAVTPGVDRARVNLATNTATVEYDPSIAGVRDFVGAIEELGFGVPEKEVPHD
    DAAQGYRRRLVVAAIFTLPVFVLGMTHGMLHVPYSPWIQLVLTLPVIFYAGAPFYAAAWSALRHGAANMNSLISLGTGAA
    FLYSLVQTVRGRHDVYYEAAAVIITLILTGRLLEARARGRAGEAIRRLMDLQPPVARVLRDGTEVELPVDSVGVGDIVVV
    RPGERIPVDGQITEGESSVDESLLTGESMPVEKRPGAQVFAGSINSAGAFRYAASRVGRGTLLQQMIEMVKQAQGSRAPV
    ARLADVVSGWFTLGVLIAAAITFIAWLFFAPFGVAMVNAVAVLIIACPCALGLATPTAIMVATGRGAERGILIKGGEALE
    MAARIDTVLLDKTGTITAGKPRVTRFTGDDVLRLAASAEQYSEHPLGKAIVEAARERGLKLAPASEFSAEAGFGVRARVE
    GREIVVGRPGATVTIDGVVAGTIEMADAMKPESPHAIQRLGAMGIDVWMITGDRRDTAATVAAECGIAADHVLSEVLPAD
    KLAAVKKLQAAGHRVAMAGDGVNDAPALAQSDLGIAIGGGADVAMEAGAVTLMRPDLNGVPDALELARRTMRIIRQNLFW
    AFAYNALGIPLAALGLLSPMLASAAMALSSVTVVTNSLRLK

    >gi|116624706|ref|YP_826862.1| thiosulfate sulfurtransferase [Solibacter usitatus Ellin6076]
    MIRKFALLALFFAALAGAATCGGHGTPETMIVSPKWLAAHLADPNLVILAVGEQNDYDAGHIPSSQFIVYKDIGEAGPTG
    LILELPPMPRLAEVFGKYGVSNSSRVVVYRLKDWLTPIARVLMTLDAMGLGRNAAMLDGNLEIWKEEGGAVTTDVPTVKP
    GKIEPCPQDDVIATLAFVRDNLHSPGFRILDARSPEAYNGDPKSVRPGIRAGHIEGAGNVHYDSLLTPKGKLLPAADLQA
    KFTAAGVKPGDRVVTY
    CFIGQQASALYWFSRYLGYDTRLYDGSMDEWSKHDELPIVK

    >gi|116624809|ref|YP_826965.1| redoxin domain-containing protein [Solibacter usitatus Ellin6076]
    MKIAGIISISLLWAAAGSAQQIAGLWDATVKVAGNEIPFRMEFAGTGDAVRGNFFNGEERVASSGGTLREGTLRLNFDSY
    ASRLEASVTQDAIDGRYGREGRWYEFHARPAAKAAASAEGVPNIAGLWEIPTKSSKGESAWRLIVQQKGAEVSATILRVD
    GDTGALTGTWHGGRLVLSHFSGARPNLLEVTQAADGSLKLLQNGKTSLTAIRPAAARAQGLAEPTDPFHHTGVKDSATPL
    SFAFPDLEGRVVSLDDPRFQGKVVVVAISGSW
    CPNCHDEAPFLEELYRKYRAQGLEVVALSFEEAEQLKTLTRLRAFVKE
    YEIDYTVLAPGEPAELAEKFPRGDNLNSWPTTYFLGRDHRVRGVHAGFAGRASGDFHRQTRDEITGIIERLLAENTTSEA
    SRAR

    >gi|116624971|ref|YP_827127.1| peroxidase [Solibacter usitatus Ellin6076]
    MSLRINSEAPNFTAETTQGPINFHEWIGDGWAILFSHPKDFTPVCTTELGYMAGLAPEFAKRNVKIIGLSVDPVTNHGKW
    AADIEETQGHAVTYPMIGDPELKVAKLYDMLPEDAGTTSEGRTAANNATVRTVFVIGPDKKIKLMLIYPMTTGRNFDEVL
    RVIDSMQLTAKHQVATPVNWKPGDDVIIVPAVSDDDAKKKYPEGFKTIKPYLRTVAQPK

    >gi|116625220|ref|YP_827376.1| DSBA oxidoreductase [Solibacter usitatus Ellin6076]
    MKLSLTLSLIPLLVCALSTARASDTGTPSGSTVVVDIDGVKLTADDVEQKLPGRLLQARATYYQTERKTVDEFIETYLLD
    RAAKAENLTVDALLERHVNSAIAKDPSEETLRIYYEVVNTTEPYEKVRPQIVERIRQVRIAKLKAAYVESLRAKSNVAIL
    LPAPRAKVSLAGAPVRGAADAPVVLVEYADYE
    CPYCQMVQPALDKVLGDYKGKVAFAFKDVPLPMHANAIKAAEATRCAE
    AQGKYWEYHDLLFSTKMVEPARLKEHARTLKLDTAAFDTCLDSGAKSDSIKTALNEAQDLGLNSTPSFFINGRFTQGNLS
    YEQLRQIIDEELALVPARRAANQP

    >gi|116625266|ref|YP_827422.1| methionine sulfoxide reductase A [Solibacter usitatus Ellin6076]
    MKLSMRTGAVALSGAIACFLTLRALTAGEIPPPFADVPAPTTNQLATAVFAGGCFWGVEGVYEHVKGVKAAVSGYAGGPA
    SMAHYDLVSNGDTGHAESVKVTYDPAQISYGKLLQIFFAVAHDPTELNRQGPDWGTQYRSAIFYSSEEEQRVATAYIEQL
    NAAKAFSKPIVTQVAPLKAFYPAEDYHQHFLERNPTHPYIVYNDLPKIAQLKRRFPELVTKK

    >gi|116625267|ref|YP_827423.1| redoxin domain-containing protein [Solibacter usitatus Ellin6076]
    MRIPLVLTLYAACLPAAAQTTDTFEITQVWPPVEVTLSKAPVEFHARVRYTLASMERAVLTIGAEHYWGIAQNCSDPDAS
    HQTEGATRTQLQKGTGEIDVTLIWLGDAASRIKMPKGAPTFLGLGGRIWPEENGAPVPPEGSYISSSHCYGVMASEPDTT
    SVLEIDPSRTSERLLGSWAGTDPRNLTEMIVRRDAGRILAHAWGACHPVDCDWGEEVVQVSNGIGTATWDHGFATRKMQL
    TPQRDGVLQVVMSSAYHDNSGRPNQTTIQLFTRRIVPQDDAPTAAARALLAQVAKQFRTTPSYDESISTEIRDRTPTRVK
    TYRLSPDRYRKEVDNGNESWVSLSDGKSFWTIYPASNQYTVSPQSNKIGSSLISDPIRGTPRITGHETLYGAACTIVRKK
    ASIGVIESYWIEDERHVLRKLTVEVGGRVQSEIQYPVVRLGEEMKADLFAYDPRATNATEWRMGSRPTPFSSLAKTAPDF
    TLPDLGGREMTLSALKGKVVLIDFWASW
    CGPCRQALPTIEILHRGLRDKGLVVLGIDNEAASVIRQYVESQGYTFTTLID
    AKGNAVDLFHVAAWPTTVVIDREGKVAYYNAGHDPEKLRDVLRKLEVW

    >gi|116625554|ref|YP_827710.1| thiosulfate sulfurtransferase [Solibacter usitatus Ellin6076]
    MKRTWIGLVLSCLMAAHTIAAATCGGHGDRATMLVTTGWLAQHLKDKNMVILAIGQEAEYKEHIPGAISLRLDEVTTPME
    MGKLMYELPPIDQLQKTLTALGITNDSRVVLYLSNQGLAAMTRVYLTLDAIGLGARTSILDGGLKVWKSENRPVTAEVAA
    VKPGKLDLCPQGDVIALMDFVKSNINHPGVRILDARAEQFYTGQTAGKTHDGQDQRKGHIPGAGNLRFSSLYDEQGKFNS
    PDKLKAQFTEAGVKPGDKVVSY
    CHIGQQATVVYFAARYLGYDARMYDGSWDEWSAHAELPVEVSAK

    >gi|116625806|ref|YP_827962.1| redoxin domain-containing protein [Solibacter usitatus Ellin6076]
    MKSAILGLFLAASALYSQDQHVTWKVTVEPPSAGPGSTVLLRMAGHIEEGWHLYSMSTPAAIPTKIQLAPSPAVESFRAL
    QPEPKRAFDANFNSDTETYEGEVAFLLEVHLKKDAPAGPAELALSARYQTCNPKMCVPSKWSGSATIAIDPAAPASTATI
    PAGYSEPKPHTANPATSTSAAAPPEGLAAFLAVAFGFGLASIFTPCVFPMIPITMSYFVNRQSGGRRESIVQALVFCLGI
    VVLFSGLGLATTAILGPFGIVTLGSNPWVNGFISALFIAFGLSLLGAFEITIPSSILTPLNKSADKGGFLGSLLMGLTFS
    LASFACVGPFVGTLLAASVSGGKTRPLIGMVTFATGLALPFFLLAVFPGYLKRMPRSGGWMARVKVVMGFIILAFSLKYL
    SSLDQVLQWGILTRERFLAAWVVLFAMAGLYLLGFLRMEGIKPDEPVGLGRLLPGAAFLIFAISLLPGMFGGKLGDLDAY
    VPLASSQSAGIGGGAGESSLVWMKNQYREALDRARKEGKLVLVNFTGYA
    CTNCHWMKANMFTRPEIAAAMKNFVLVELYT
    DGTDAESEAHQKLQLSKFNTVAIPFYAIIDPDEKVVATFPGLTKDSAEYLAFLQKTPAPLNVNASAFPQFSKLDGAPADT
    AGLSGKVVVVNFWATW
    CVPCIQEIPGFNKLHKDGVSVVGIAMDEEGAARVEPFLKKHPMDYPVGIGSEALNEQFNLDQLP
    VTLVFDRAGKQIKRFEGFTPDAEILAAVKQAL

    >gi|116626111|ref|YP_828267.1| redoxin domain-containing protein [Solibacter usitatus Ellin6076]
    MLVGAAAAADRQAVRADLQPPAERKAAPEFALRDSSGRSVSLKKFRGKVVLLDFWALWCHGCKEEIPWFVEFQRKYGSKG
    LTVVGVSLDEEGWKVVRPFLAKASIPYRILLGNEATAKKYGTENMPDAFLIDRHGRIAATYVGLVDRGNVEANLRTMLNA
    D

    >gi|116626219|ref|YP_828375.1| thiol peroxidase (atypical 2-Cys peroxiredoxin) [Solibacter usitatus Ellin6076]
    MERPGATTMRGNPLTLVGPELKPGDAAPDFNLVDGSLKPVTLKDTGNHVRIISVIPSLDTPVCDAQTKRFNEEAAKLQGV
    DIITVSMDLPFAQKRWCGAFGVDKVKMLSDHKEASFGSNYGTLIKDLRIESRAIFVIDPENKIRHAEYVKEVADFPNYEA
    ALTAARGAGAATS

    >gi|116626220|ref|YP_828376.1| hypothetical protein Acid_7180 [Solibacter usitatus Ellin6076]
    MHTNRLAQEKSPYLLQHAHNPVDWQPWGPEAFERARQENKPIFLSIGYSTCHWCHVMERESFENEEIAALLNRDYIAIKV
    DREERPDVDRIYMTFVQATTGSGGWPMSVWLTPELEPFFGGTYFPPENRWGHPGFGSILTQIAGVWRDNRPQVVESARDV
    IEQLKKHVEVAPSHGGVAFDQATLDSGFSVFRRTFDTRTGGFGAAPKFPRVSIHHFLLRYYARTGNKEALDMVLLTLREM
    ARGGMNDQLGGGFHRYSVDDRWFVPHFEKMLYDQAQIAISYLEAFQVTGDAQYADTARAIFDYVLRDMTDSGGGFYSAED
    ADSIITPEQPTLKGEGAFYIWSMEEIHALVGAPASDWFCYRYGVREGGNVENDPHGEFTGKNILYQQHTLEQTAEHFGQP
    AGEMDATLDNAARILLQARAKRVRPHLDDKILTSWNGLMISAFAKGGAVLEEPRYAEAARRAAAFVAGRLCDAASGTLLR
    RYREGDAAIPGFLDDYAFFVQGLLDLYEAQFDLSHLQLAIRLTEKQLELFEDREAGAFFSTIDGDPELVLRVKEDYDGAE
    PSGNSVSVMNLVRLAQITNRDQFRQSAGRALSAFASRLSVAPMAVPQLLAACEFVTGQPREIIFAGTRDSAELQAMLHEL
    HRRFIPNRVVLLVDSAEARKTLAGGIPSIESMLPADGRATAYVCRDYTCQLPVSDPANFAELIQ

    >gi|116626290|ref|YP_828446.1| glutathione peroxidase [Solibacter usitatus Ellin6076]
    MMKMMLLGMAMGAMAFGASSVYDFTLNSIDGAPTPLSTFKGKVVLLVNVASKCGFTPQYAGLEKLYEKYKDQGLVLVGVP
    ANNFGAQEPGSNEEIKTFCSRNYNVTFPMMSKVSVKGADKTPLYQYLTDASANPKTAGEIKWNFTKFLIDKKGNVINRFE
    SAVTPESADMLKAIEAALAQ

    >gi|116626312|ref|YP_828468.1| beta-lactamase domain-containing protein [Solibacter usitatus Ellin6076]
    MYFQQFYLGCLSHASYVIGSGGIAAVVDPQRDVGIYIEDAVKHGLRIAHVVETHLHADFISGHQELATLTGADIYLGAEA
    GAAFPHVPVRDGDELRFGNCVLRFLETPGHTLESISILVTDLERSPDPYAVLTGDTLFIGDVGRPDLAPNHTPQQLAGML
    YESLQKKLLTLPDGVEVYPAHGAGSLCGRQMSAERSSTIGQQRTANFALQAKSKEDFVRLLTAELPERPGYFALDAELNR
    SGPAPLADLPVPAALLAKEVLAMQKDGVLVLDTRPTSQFGGAHIPGAIHVGLAGQFASWAARLIGLQAKIILVAEERDAM
    LDARTRLARVGLENVAGYLEDGMTAWFREGLPVDQVPQVTVQDLHREIAHVQVIDVRQPGEWEQGHIAQATHRPLPKIPG
    NLDGLDRDQAVAVH
    CKSGYRSSIATSLLKREGFKNVMNVIGGYDAWVACGLPVVQAEPSPQSAGT

    >gi|116626461|ref|YP_828617.1| rhodanese domain-containing protein [Solibacter usitatus Ellin6076]
    MMHSPGFLKLVTEAKSRVKEIDLGAYQEMREAGEPHLLVDTREDNEWAAGHVAGAVHLSKGIIERDIEGKVPDKDTKLIL
    Y
    CGGGFRSALVADNLRQMGYTNAISLDGGWRALKESGLPLE

    >gi|116626747|ref|YP_828903.1| redoxin domain-containing protein [Solibacter usitatus Ellin6076]
    MLKVGDKAPDIRVHTDTGEDFRLSELKGKRVVLYFYPKADTPGCTVEACEFRDGIKGFNKKGAIVVGISPDKPSSQAKFK
    EKYDLPFTLLADEDKAAAEAYGVYKEKNMYGKKVMGIVRTTFVIGADGKIEKIYDKVKAQGHAAAVLEDLT

    >gi|116623894|ref|YP_826050.1| glutaredoxin 2 [Solibacter usitatus Ellin6076]
    MKPRVTLYTRAGCCLCDEAKHVISEAHAHADFEYEELDIDSDPDLLRLYNDEVPVIAINRVKAFKYRVNMNDFLKKLAAR
    A