Candidatus Ruthia magnifica Cm Calyptogena magnifica uid58645

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|118602103|ref|YP_903318.1| thioredoxin reductase [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)]
    MSENKHCKVLIIGSGPAGYSAAVYAARANLNPIIVSGMEQGGQLMSTMGVDNWPGDVAGVQGPDLMARMKKHAERFDTQI
    LNDTITSVNFTKRPFVLKGETTTYTADAVIIATGSSAHYLGLESEEKFKGKGVSA
    CATCDGFFYRGQKVAVIGGGNTAVE
    EALFLSNIADHVTIIHRKDKFSSEKILSNQLIEKAKIGNITIEYNHNLDKVLGDTMGVTGLRLKDNDGKTKNIDVHGVFI
    AIGHTPNTAIFEGHLEMSHGYIKVQSGTQGNAMQTSVEGIFAAGDVTDHIYRQAITSAGSGCMSALDAERFLGE

    >gi|118602152|ref|YP_903367.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)]
    MSVLVTQQAPDFTAAAVLADGSIVDNFQLSNLKGKKIVLFFYPLDFTFVCPSEILACHHRMMQFNDKGVEVIGVSVDSQF
    THNAWRNTAPADGGLGVIDFPLVADTDHSIMEAYGIVHPAGIALRASFLIDENFEVRHQVVNDLPLGRNIDEMLRMVDAL
    DFHTEHGEVCPAGWNKGDEGMKDTPAGVSDYLSKHADEL

    >gi|118602189|ref|YP_903404.1| electron transport complex, RnfABCDGE type, A subunit [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)]
    MNEYVLILVSTILVNNFVLVKFLGLCPFMGVSKKIDTAIGMGFATTFVLTLASIFSYLINTYILLPFEIEYLRTISFIVT
    IAGVVGFTELVVNKTSPILHQSLGVFLPLITTN
    CAVLGVALLNVNQDNGFLASGVYGFGAAIGFSFVLVLFSAMRERIDV
    VDVPEAFKGTPVALITAGLMSMAFMGFIGLV

    >gi|118602241|ref|YP_903456.1| methionine-R-sulfoxide reductase [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)]
    MNLVKKLTPEQFRVTQQAGTEAPFTGKYYNYQEQGNYLCVCCHQILFSFNTKFDSNMGWPSFSNASKSDSVKLITDNSHG
    MSRVEARCSNCDAHLGHVFSDGPTSSGNRY
    CINSASLDFKPS

    >gi|118602254|ref|YP_903469.1| thiol-disulfide interchange protein DsbC [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)]
    MLKLLFITTVLFSNNAFADKNAIINTLYPFFGTIDKQYIINTPLSDIFEITLRNLIDSLLVSKNDRYLIQNNVVDLTTTA
    RQLIPMNGNVKLIKQALINTIDDHDKIIYPAKNEKYIIHVFTDVD
    CPFCKKLHNGMKQMNDLGITVKYLASPLASLHPAA
    QGKMERIWCADDPVKAMDDYKKNKIILNLKTCHNPVANQLAISKQLGVNGVPTIFLEDGTHLLGYMTPAILLQKIKATIG
    K

    >gi|118602327|ref|YP_903542.1| NADPH-glutathione reductase [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)]
    MNTDYDMIAIGAGSGGLSAVERAAEYGRKCLIIEVKIIGGTCVNVGCVPKKVMWFAANTGSIIKNAKGFGFEVEQKGFSW
    KKLKVGRDNYIKSITNWYDSYLQKLGIDYIHGFGQLVDKNIVSVNGKEYTAEYIILSSGEEPAVPHIEGSEYGITSDNFF
    ALEALPKKVAVIGGGYIGVELAGVLNALGSEVTLFCRADKLLRGFDSMIQNTLDKDYSSHGITIHHNTQIDKVSKNKTLF
    TNQGAFTGFDTIIWAVGRNPMTQHLGLKVAGVKCDQKGFIQTDKFQTTNVDNIFALGDVTGRTSLTPVAIAAGRRLSDRL
    YNNMTDRHLDYNNIATVVFSHPPIGMVGLTEAQANEKFDKIKIYKSEFTPMADALLEHKTTTALKLVCAGDNEKVIGCHI
    MGHGADEILQGFAMAIKMGVTKKQFDDTIAIHPTISEELVTMR

    >gi|118602357|ref|YP_903572.1| redoxin domain-containing protein [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)]
    MTKNLIIPPRLAFQLGNKIAKIGFICSLFLAFNVAQAISIDDMWQKERKIKVPDFSLTDLNGNIHTNKSTLGKYLVVNFW
    ATW
    CPPCLKEIPDFVKFYEKNKDKVLILGLDYEQAGKAAIIEFTDTFMVNYPIILFDDKNYAQFKKFDEILGMPTTYIYG
    PNGNLVDYQMGEMDMMALEKAISK

    >gi|118602358|ref|YP_903573.1| arsenate reductase [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)]
    MSTVIYHNPRCSKSRAMLTILEQKNVDFEIIKYLENPPTSNELKQLLTDLNLEARSLMRKGEPEYKEQGLDDEALTENQL
    INSMIKTPKLIERPIVRTSKGVVIGRPPENVLSIL

    >gi|118602359|ref|YP_903574.1| glutathione S-transferase domain-containing protein [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)]
    MKLELISFKLCPFAQCAIILLNKQKLDFELNHINPMNPPNWFKQISPTEQVPLLKVDERIIFESSVITEFINDISKTNLH
    PSDPIQKAENRSWIQFSSTLFDNLFGIVTGDEEKFHTSKKSLFDKLAKVEVVKNNTKFFNGNNFSIIDAAFAPIFMRLNW
    INEFTNNILSLNEFKHLSTWSKELLQVDVVKNSVVERLNDVYYSNIEAREGHLLTLLID

    >gi|118602378|ref|YP_903593.1| hypothetical protein Rmag_0346 [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)]
    MLDFATLGSDFFSNIDTQSLKQPFLIHKNQALQDRLKLSIKDNELLNIASGKNKFQCMQPIASIYAGYQFGHFVPQLGDG
    RSCLIGQVQGLELSLKGAGQTPYSRGADGRAVLRSSIREYLCSIAMKGLNIPTTEALTLVGSHSEVYRENIETGAIVMRC
    APSHIRFGHFELFAVRGQISQVRQLADFVIEHHYQYCQGENQYIDFFNEVVQKTAIMIAHWQAQGFVHGVMNTDNMSILG
    LTIDYGPFGFLETYNPKFICNHSDHEGRYSFDQQPNIALWNLSRLADSLSSLINTKQAKLVLDKYQNYLVESYSVLMRQK
    FGLHEKDKQDHVLITQFFDMLYQHKKDRTNSLRQLSNVDKLAINTDFNDWIELYDKRVSQENNRNRISMMNSVNPNYILR
    NYLAEVAIRKAEDDKDYTEIEILFDLLSKPFEVHQDMEFYTYEAPDWAQGLTVS
    CSS

    >gi|118602414|ref|YP_903629.1| glutaredoxin-like protein [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)]
    MDVMDRIQQQVDSAAIILYMKGTPQFPQCGFSATAARTLASTGVEFTYVNIFEDQEVFQSLPVFADWPTFPQIYFNSELV
    GGGDIIVEMADMGTLKGEMEKASEKFDTK

    >gi|118602488|ref|YP_903703.1| thioredoxin [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)]
    MNDKIKVVTDASFEANVVNSSQVVLVDFWAEWCGSCKALMSVLDEIADEYDGKVIITKINIDENDQTLLKYGIHGIPTML
    LFSDGVVQATKMGALSKAELSTFIDANI

    >gi|118602582|ref|YP_903797.1| iron-sulfur cluster assembly protein IscA [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)]
    MAITLTDRAVERVADFLTNRGFGIGIRLSVQTTGCSGLGYNIEFVDNTNNDDTVFEGNDIKVIVDAKSLIYLDGTQVDYI
    KEGLNEGFEFNNPNAKAECGCGESFTV

    >gi|118602613|ref|YP_903828.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)]
    MNKVQPITCTATSDLEINIPDTQGRHIVLYFYPKDATPGCTTEGQDFRDNHQAFADANTVIYGVSKDDLTKHEKFKAKQN
    FPFELITDVGGTLCELFNVWQLKKFMGSEYMGIVRSTFLIDANGNILKHWNKVKVKGHAEEVLAYLQAL

    >gi|118602636|ref|YP_903851.1| UBA/THIF-type NAD/FAD binding protein [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)]
    MNDQELIRYARQILLPQIGVKGQQTLKNSTLLLIGMGGLGSPSALYLASTGIGNLIIADFDEVELSNLQRQIIHFIDDIG
    RKKVDSAKDKMLAINPNIKVTTITALHQNNLNDWVAKADVVLDGTDNFDTRFKVNKACVMQKIPLVSAAVIRFEGQLSVF
    KGYEQTQPCYQCLYSVKGNFDEN
    CVDNGILSPVAGIMGSLQALQAIKVLLNLGEKLVGKLMLIDALDLSFRKIKINKDES
    CKICANGA

    >gi|118602637|ref|YP_903852.1| peptide methionine sulfoxide reductase [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)]
    MQITYFAGGCFWCVEAIFQRIEGVVKLTSGYCNGNTVDPTYQDICTGTTGHAEVVKVEFYELKVSFKTLLNIFFEIHNPT
    TKNQQGNDRGTQYRSAIFYTNDEQQSQAIDMVNQMSDKIVTQIIKLDVFYPAENYHQNYFNNNSSQPYCQMLIAPKLNKY
    FNQ

    >gi|118602678|ref|YP_903893.1| thioredoxin, putative [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)]
    MKKRKIILQWLLVIIAIFSFRAYQQRNLNSGIVPSFNSKTLNGVIVSSHSNETTLIHFWATWCSICQLENDNIQTISRDY
    RVLNIAMQSGSDTDLKAYTQEHNMKIDNIINDNSGSLSKLLGVKATPTNFFISKDNQIKFSEIGYVSTLGYRLRLWWTSL


    >gi|118602704|ref|YP_903919.1| thioredoxin [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)]
    MAVLELSQSNFDETIQNNNIVVLDFWAPWCGPCKQFASTYDEVSDKIDDVIFAKVNTEDEQELASNFQIRSIPTLMIFRE
    QVAIFSQPGAMSSTDLQAVIDKAKALDMNKVREEIKK

    >gi|118602705|ref|YP_903920.1| hypothetical protein Rmag_0717 [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)]
    MYGIKNCDTIKKAQKFLINHQIDFEFIDFRDNPIDKTKLQTFVDKLTLEKLINKRSTTYRNLNDKEKDNITLELVLKNPT
    LIKRPVLVTNNDIMVGFSKKSYSKLC

    >gi|118602769|ref|YP_903984.1| electron transport complex, RnfABCDGE type, E subunit [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)]
    MSDYIKIIKNGLWNNNQALVVLLGLCPLLAVTNNIVNAIGLGLATTFVLVSSNITVSIFRHQISKEVRIPIFVLLIASFV
    TIVELLMQSYFYDLYLVLGIFVPLIVTN
    CAILGRAEAFASKNTWGKSAIDGLMMGVGFSIVLIVLGAMRELIGSGTLFDQ
    SALLLGGDLGNTLNVTVFKNYQGTLLATLPPGAFIGLGLIVAMKNRYDLRRVELQKN

    >gi|118602840|ref|YP_904055.1| DsrE family protein [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)]
    MKISIQINEGPYQHQASDTAYQFAKAAIEKGHEIFRVFFYHDGVNNASRFTLPPQDDRNVVNQWAELDIKNTDGEPELVV
    CIAAALRRGMLDESEASKNGIDGNNIHPAFRISGLGQLIEAGIRSDRLVIFGD

    >gi|118602901|ref|YP_904116.1| rhodanese domain-containing protein [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)]
    MEILEFLFADEQMFTTITLILLIALLVGNIVVDKLKKYEDIDANGAVTLMNNNDLILLDVREEKERKMGYIAGDIHIPLT
    SVKGKLSSLDKRKKLLVY
    CRSGSRSAHIAGLLTRNEFKNVYSLKGGFQAWKKAKLPIKI

    >gi|118602902|ref|YP_904117.1| glutaredoxin [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)]
    MKKNIIYCSYSCFFCQRAYQLLKKRDISFKKYHVKNIGDWNEVKEKIGRKTVPKVFINDFHISRFDDLLTAEQSGKLDEI
    LN

    >gi|118602907|ref|YP_904122.1| redoxin domain-containing protein [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)]
    MVSTKTPICDFNTPAIDFSLKGVDEKMHTLKSCKGKNGLLVMFICNHCPYVKAIIDRIIYDTRIFKAIGINSVAIMSTNP
    NEYEVDSFKNMQKIAMSMNFPFPYLMDKTQQIANAYGAVCTPDFFGYNADLKLQYRGRFDASRKESIAVGIKRDLFDAMS
    QIATTGQGPKEQIPSIGCSIKWLHSVD

    >gi|118602920|ref|YP_904135.1| DSBA oxidoreductase [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)]
    MKKILFSLLIIFSSFAFSQDYEAGIDYVVLDKPVKTTTGNKIEVRELFWYYCLHCYNFEPLMNEWFKTKLSNVEFVRQPA
    IFSKRWLNGAIFYFVLEELNLVEKLHEVLFDTIHTKNKRFNSKESFISWVTSFGVDKTKIEKAFDSFSVKIKVNKSKLNT
    LKYKVTGVPVMVINGKYLIDATHAGSHTNMLKVVDFLIKKESKLE

    >gi|118602927|ref|YP_904142.1| dihydrolipoamide dehydrogenase [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)]
    MIIKTQIVVIGSGPGGYTAAFRAADLGKQVVLIERYDALGGVCLNVGCIPSKALLHTAKIINEAKEASHLGVTFNEPSIN
    IDDVRTNKTNIIAKLTGGIKALAKARKINVITGYGKFISSNQLAIENSDDIIEFEQCIIAAGSRVTKISVFPFDDARVMD
    STDALDLTNIPKRLLVVGGGIIGLEMATVYHALGSEISIVELSDQLITSADKDIVNPLFRRIKKQYTNIFLNTKVINMNA
    LKEGIKVGFEGKNAPEFDIFDKVLVAIGRTPNGKLINCEKAGVEVNDWGFIPTDKQMKTNVQNIYAIGDIIGQPMLAHKA
    VHEAKVAVEVIYGHKLGFDALTIPSVAYTDPEIAWTGKTEKELKAEGISYEKGVFPWAASGRSLSIGRSEGMTKGLFDTK
    TGRILGMGICGTNAGELITEATLAIEMGCNMDDIALTIHAHPTLSETIAFATEMAQGTITDLLPPKNRKQL

    >gi|118602971|ref|YP_904186.1| rhodanese domain-containing protein [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)]
    MFNSFSSSDACKLLANGAQLVDVRSSSEFAQGALPNAINLPLQSIMSADQIIDRNKVIILYCVTGTRSSIAKNYLIQIGY
    ENVNDLGSFKNYNCE

    >gi|118602973|ref|YP_904188.1| rhodanese domain-containing protein [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)]
    MDGYQKLVAQALATVDEVFPWNLEEEIKHNTDLILLDIREQNEFDTMHIKCSIHVPRGVLESACVWNYDDTVPELAQARD
    QNIVVI
    CRSGNRSTLTVFTMQQMGFTKVRSLKMGIKGWNDNDFEMVNVNHTIVDIDEADKWLNRVVSEDKLTPCKNNVNN
    T

    >gi|118602989|ref|YP_904204.1| heavy metal translocating P-type ATPase [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)]
    MSNVCYHCGLEVTNHNKVQMSIENKQKDFCCAGCANVCQTIYLNGLGSFYHQQTNSLLPAVDLEYPVEFYDADAFQQSFL
    ELSDERTKTIILISDTIH
    CAACVWLIERAIGTLDGIIWVRVSLINKRIRLSWVDVDIQLSVIMKRLADLGYAAMPYEQNI
    AESIANKANKAMLYRISFSAFTMMNLLWISIAMYTGAAGGEYHNYFQWLGFTLATPTLFYAGMPFLKNAFFGLKNCFMNM
    DVPISIGVLSTYFYSVYVLLGVSTKNEVYFDTVVNFIFVILIGRYFEGSAKKSTLSASNALQQLQPKVAYVVSKDEVKIT
    PVGAIKIDETVLIKPAERLAVDGIVLSGDSEVDESLLTGESLLVRKQFGDEVFSGSINTSGSLMIRVTKTLNNSALGQIV
    SLVESMQYNKSSIICTLDKVIPYFVGTTIFLAIVTFIYWYPYDFDLALLSATSVLIITCPCAFGLATPMSIAVASGAAIK
    KKILIKNNDVFEVLGKVDWVVFDKTGTLTKGEFSISHIETLIDKINFINIMVSIEKHSEHPLAKAIVGVDMANSTLEVSE
    FYADHGQGVRGVINQQSYKIGDLSYVDIKHQVDANLLNKSRLLGQQGVICIWCANESNVLGFIALKDQIKSDTAEVVNQL
    KFIGKQVSILSGDSEIVTQTIASKLGIEHVIAQALPKDKADYIKQLQQNHTVLMVGDGVNDAPALVQADISIAIGAGSDV
    SINSADLVILKPTLSSIIELINLAKHTNNTIKQNIIFALLYNAFMVPLAMMAKVTPLFAAIVMPISSLIVIGNAARLRNK


    >gi|118603017|ref|YP_904232.1| protein-disulfide reductase [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)]
    MKHLLLPLFLLLSAFSLTQAEDDLLPVDKAFAFKVKVVNNEILLNWDIAKGYYLYKEKIKISANLSIQLGSAKFPTAKII
    NDEFFGKIGIYRDNTVVVVPVLKGDAKSILLTVIYQGCADLGVCYPPIIKSFVLNINSIRSTSLADNAFNLFTRATNKTQ
    SIIEKIIPISDEPLSADDAFRFSVVAIDANTLLARWTIHQEYYLYHDRFFFDIKGAKFGDIVLQKGQIKNDKFFDKIEIH
    KGLLKVKIQLTDVNTQPITFIVKYQGCWENGVCYPPQEKTKEIMLPYQTDNSNINIVPEKAKILNVAQVELNEIGQITAL
    FQQDSILLVLASFFGFGLLLSLTPCVFPMIPILSGIIVGQKEEVSTKKALIMSIVFVLSMSITYSISGILAGYFGENLQA
    LFQTPWILSIFSLIFVVLAFSMFGYYEIQLPANLQGKITKISNDQKGGHLIGVTVMGFLSALIVGPCVVPPLAGALIYIG
    QTGDALLGGLSLFIMSLGMGVPLVAIGAGVSKLPKVGGWMYSIKYIFGILMLAVAIYLLDRIISPLASLVLWAMLITISP
    IAMGTLNTQTSASSSWQRIFKALGLIILGYGVLLWMLIARGGGDMLQPLSSWSTSSIVTESVHIKFKRIKSMDELDQILE
    KEKSSDQIVMLDFYADW
    CISCKELERFVFSNVNVVNEMTNVTTLQADVTENNTNDKAFMKRFGLVGPPAILFFKNGIENR
    SQRIIGEINAQNFLSHLNKTK

    >gi|118603022|ref|YP_904237.1| iron-sulfur cluster insertion protein ErpA [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)]
    METKQALEKADIIFSDNAAKKVSTLIEEEKNENLHLRVYITGGGCSGFSYGFNFDETYKEGDSSVENNGVQLVVDPMSYQ
    YLIGATVDYLEDLQGARFIIHNPNAKTTCGCGSSFSV