Candidatus Puniceispirillum marinum IMCC1322 uid47081

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|294083589|ref|YP_003550346.1| Iron-sulfur cluster assembly protein [Candidatus Puniceispirillum marinum IMCC1322]
    MFDPNKPIVTLTDKAALHVQSLMNKAESDVIGLRVGIKTTGCSGMQYDVQFATEQKPFEDKVEEKGVTLFIDPTAVMFLI
    GSEMDWQEDKFAARFVFNNPNEIARCGCGESFSVAS

    >gi|294083649|ref|YP_003550406.1| Peroxidase [Candidatus Puniceispirillum marinum IMCC1322]
    MSLRINDIAPDFTAQTTQGDLSFHEWLGDSWGVLFSHPKDFTPVCTTELGALAGLQPEFEARNVKVIGLSVDPVEDHNSW
    LQDIADVTGHMPNYPIIADTELAVAKLYNMLPREEGTSHAGRTAVENQAVRSVFIVGPDKRIKLTLTYPMATGRNFAELI
    RTIDSLQLTATHKVATPADWQHGDDVIIVPSVSDDEAWTLFPDGWQTIKPYLRKVADPTKP

    >gi|294083666|ref|YP_003550423.1| methionine-R-sulfoxide reductase [Candidatus Puniceispirillum marinum IMCC1322]
    MSDKIIKTDAEWRDMLTDEQYHITREHGTERAFTGALCDNHADGTYQCICCGADLFDSDTKFESGSGWPSFYQPAENGAV
    GETEDRSLFMRRTEVHCNRCDAHLGHVFPDGPQPTGLRY
    CINSASLDFVDKDAESE

    >gi|294083705|ref|YP_003550462.1| ArsC family protein [Candidatus Puniceispirillum marinum IMCC1322]
    MSMAATMKNNLTIYALKTCDSSKKAISSLRVAGHEVLVVDVRADGVSDDLLASWLALHGADVMINRKSTTWRNFDEATKA
    ESPLALLRAHPTLMKRPVIVDGDHVHVGWGKDVQTAFSI

    >gi|294083778|ref|YP_003550535.1| Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzyme [Candidatus Puniceispirillum marinum IMCC1322]
    MAETKSDTKSFDIIVIGGGPGGYVAAIRASQLGMKAAVIEREHLGGVCLNWGCIPTKALLRAAELRHSIDEMKEFGITIS
    GEVGIDLPTVVKRSRKVAGRLSMGVSHLLKKNKVTVFEAEAKIGAKKGDIRTVTLADGTILQAKHVIIATGARARSLPDI
    TPDGKTILTYKEAMVPESMPESLIIIGSGAIGSEFASFYHDMGVKVTLVEAVDRILPVEDPEISAIVQKAFVKRGMQVIT
    GVMMASLKSNGKSVTATFDGTQEPVTADRAILAVGIIGNTENLGLDGTKVKVDRGHITTNQWAETGEAGIYAIGDVTGPP
    WLAHKASHEGIICVEKIAGQKDVHAIGAGAVPGCTYCRPQVASVGMTEAAAKEAGHKIKVGRFPFIGNGKAIAMGDDQGL
    IKTIFDEKTGELLGAHMVGPEVTELIQGYAIARTLEATEAELMQTIFPHPTLSEAMHESVLDAYGRAIHM

    >gi|294083798|ref|YP_003550555.1| putative dithiol-disulfide isomerase involved in polyketide biosynthesis [Candidatus Puniceispirillum marinum IMCC1322]
    MTEMTNMTTMYDKTIQVDVEIYADIVCPWCFIGKRRLDAAFARRPHITPRYIWRCFLLNPNMPVDGMNRQAYLHAKFGDS
    AHAVYGRIAEAGLDTGINFNFDAIDKTPNSRHAHKLLLAAGSDSQSLSERLYSAYFIEGLDIGDNDVLDRIATESGHAEL
    IEARHDISFEHQLDHDLAMARRLNMDGVPYFVFGGSYAVAGAHEADHLLPAIDAAAS

    >gi|294083800|ref|YP_003550557.1| glutathione S-transferase-like protein [Candidatus Puniceispirillum marinum IMCC1322]
    MPILWSFRRCPYAMRARLAIDASQQQVELREILLRDKPDRFIAVSPKATVPVLQCDEGKIIEESRDIMFWALKRNDPEGW
    LDIWRQNPAYVTAFLDRLDGAFKTNLDRYKYASRYDADAALKHRDAGVVFIAELDNILAQKPALSGDRLGVLDFACLPFI
    RQFRIADSMWFDKQNWLALHKWLQTFLTSSRFERVMKKYSPWHEGEQGVDFP

    >gi|294083871|ref|YP_003550628.1| rhodanese domain-containing protein [Candidatus Puniceispirillum marinum IMCC1322]
    MPQNINKSVKDLVKAAISAVPTISVDDAMDLVGSPDHVFVDLRDGTEQAKTGIIEGAIASSRGMMEFHIDPESPVHKPEF
    NQDKTYVFY
    CASGGRSAMAALVAMDMGLSPVVNLAGGVGAWKKAGGVLS

    >gi|294083993|ref|YP_003550750.1| iron-sulfur cluster assembly accessory protein [Candidatus Puniceispirillum marinum IMCC1322]
    MVLNKMSEIISKTANSETVTPSSMAGIFSLTEAAADRITSMLAAEPDGSFFRVAVLGGGCSGFQYQFSIDTNRDDEDQVF
    TSHNVDVIIDEMSLELVDHAELDYVQDLMGSYFAVNNPNATASCGCGTSFSV

    >gi|294084004|ref|YP_003550761.1| selenide, water dikinase [Candidatus Puniceispirillum marinum IMCC1322]
    MDKSSSSILGDVVLLGGGHAQIAVLKMFAMKPIAGIRLTLVTNDMRTPYSGMLPGFVEGVWDDDDLHIDLATLAQFAGAR
    IIHASCTGIDADHKRLLFDHRPTLRFDVLSVNIGGQPALDAIDGAMEHAIPVKPIAQFQHRLNDVLSADKKHKLSVIGGG
    AAGCELALALSKRWLTETGKRPELRLFSRSNRLMPYMAARAGKLIEADLNAIGAHIHKGAEVTSIHANGLSCRDGQTYDF
    DACFLVSAVKPPAWLASSTIERDENGFIRVGQNLQSLSHPYIFASGDIASLHPYSRPKAGVFAVRAGRILAQNLQRYIKQ
    QSLRPWNPQSRYLALIGTADGAAIAAHGSFGFKAHYLWRLKVWIDQRFMGKYKSLAMPPTPKTDTLDAINSDEGKHSDPA
    FAAMRCLG
    CGAKTGHETLQNAMREAVSIAIGMGADPDLMPDDSLAEDAASLPSPAPNMRILQSVDMLSEIVSDPFKLGQI
    ASVHAFSDIYAMLGKPLYSLAIINLNEAKISIQTDQLTHILAGTLLAHSKAGVKLVGGHTSEGGSLSVGFSVTGTRPEHG
    AYTPAPKDAVIILSKPIGTGLVMAGHMQLKARGNWITSTIDTMCMSNHQATKIAMEHGIEWVTDITGFGLARHVLNLANR
    AGATGCYLYPDAIISLPGAQFMADNGIVSSLAGQNQAAVRLDHNGCDQHRTPLLFDPQTSGGLAMLAKPEQADHILAALV
    ATGHHPAIVGRITHSKSGITLSAKDAG

    >gi|294084017|ref|YP_003550774.1| thiosulfate sulfurtransferase [Candidatus Puniceispirillum marinum IMCC1322]
    MAHNNNIVTAEWLKAHIDDSDLRIFDATFHIPATGRDANTEFDDGHIPGAQCFDLGVIADPDAALPHTVPSAEIFQTHLR
    RLGVNQHDHVIVYDDSVFMSSARAWWLCRLFGHTKVSYLDGGLTAWKQAGGNLEKGASTAVALGNFIAGKARDSAVAYMP
    DLRAQVEAGTAGQIVDARATGRFTGEVPEPRAGIRSGHIPGSLNVPVTSLFDPDTKLLKPTNELKQIIESAGVDLSQDIT
    TT
    CGTGVTACALALALELVGHRQVAMFDGSWTEWGTSDAPIETGTA

    >gi|294084242|ref|YP_003551000.1| glutaredoxin-like protein [Candidatus Puniceispirillum marinum IMCC1322]
    MLDAATKERIDADIASEDVVLFMKGTPVFPQCGFSAAVVGVLSHLGVKFRGINVLEDDAIREGIKAYSDWPTIPQLYVKR
    EFVGGCDIIREMYETGELTEMLQTHGIDAHPA

    >gi|294084252|ref|YP_003551010.1| glutathione-disulfide reductase [Candidatus Puniceispirillum marinum IMCC1322]
    MEYMYDLVVIGAGSGGVRAARISATHGAKVAVIEGDRPGGTCVIRGCVPKKLLMYGSMFSADVEDARGFGWHIETPTHDW
    AHLITAKNTELNRLESIYVSLLENAGATLLRGFAKVTGPHSVTVNDQDITAKTILVAVGGLPQIIDVPGMNEHAITSNEA
    LDLDDFPSEILIYGGGYIALEFAGIFNGYGAKTHLVYRGDLPLRGFDEDVRRHIAVAMQDRGIILHPGTTVDALASDNGR
    KIASLSDGSTIHVDQVMAATGRKPNTSQLGLEQVGVDMGRNGEVLVDAYSRTSIPSIYAVGDVTDRVNLTPVAINEGHAF
    ADTLYGNKPRTISHENIASAVFSQPPIATVGLTEPEATAKYAKIRVYESQFRAMKNTISGRGEKTYMKLIVDDVSDKVVG
    AHMMGPDCGEIMQGVGIAVKAGATKADFDATIGIHPTSAEEFVTMRSPRD

    >gi|294084297|ref|YP_003551055.1| peptide methionine sulfoxide reductase [Candidatus Puniceispirillum marinum IMCC1322]
    MLFQNPFKSRLPEDPEALPGRSNPIFTGEPHCVLGTPTTAPFPAHLQQIIFGLGCFWGAERLFWTIDGVYSTSVGYAGGK
    TPNATYEEVCSGQTGHSEVVLVVFDPAIVDVTYLLKVFWEAHDPTQGYRQGNDIGTQYRSVIYADDAAQLDVIRESAKVY
    GQALKASGNDEITTEIRLAPPFYYAEDFHQQYLHKVPNGYCGLQGTGVVCVLD

    >gi|294084315|ref|YP_003551073.1| thiol:disulfide interchange protein [Candidatus Puniceispirillum marinum IMCC1322]
    MDRRDCHGAWWWAGYAWWPSPRNQKWQCIMNRATFIIPLFGFLLVALIAGWTLLGMLDGQRSDNQLPSALLNKPAPTTIL
    PDMAGNKTDLGQFKGQPVLVNYFASW
    CAPCRAEAPALGLLSKRIDIVGIAYKDRLEDTNKFLAEYGNPFRAILVDKDGMT
    AISWGVYGVPETFILDANGTVLFRHAGPVTRTVLEQDIEPILESLGL

    >gi|294084569|ref|YP_003551327.1| DSBA oxidoreductase [Candidatus Puniceispirillum marinum IMCC1322]
    MLGCGSGVIWRPAVAIPITRCLRRHHIVADHSIQKENLMNRKSVIITTIIAALGMFAVGAFLYSPTPEKTATATAMPASN
    EVPLIRPHSPVIGSSDAPVTIVEFFDPA
    CESCRAFHPIVKEILSKFQGKVRVVLRYAAFHPPSEEAIRVLETARIQGKFE
    AVLERLLETQPKWAPHGREPVSIWELIKETGIDVERARRDAKLPGIVAVLNQDAADVKTVGIRGTPTFFVNGKPLPEFGA
    QQLHDLVKSEVELSERSSEEKS

    >gi|294084597|ref|YP_003551355.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Candidatus Puniceispirillum marinum IMCC1322]
    MLETGMAVPQFVVPTDKDDFNIADHHGKKMVVFFFPRADTSGCTKEAIAFSELIDDFTAANCVVIGISKDKPAKQAKFRE
    KYGLTCVLGADHETDICEQFGVWVEKSMYGKKYMGIQRASFLIDADGTVAATWPKVKVDGHAEAVLEAARAL

    >gi|294084606|ref|YP_003551364.1| DSBA oxidoreductase [Candidatus Puniceispirillum marinum IMCC1322]
    MSKIYHFVILTVLSMAAMALTQGLTSPAHADVKDSDKAAFEAIVKDYILANPEVLRDALMNLAKREDLARQAMAMQILFD
    DAGDPSMGNPDGGLVIYEFSDYN
    CGYCKRVFEPIQQVLRDDGDIRLVVKEFPILSQSSLVAAQAGIAAEKQGKFTDFHIN
    MMTYRGKVTTQSIMDAANEAGIDTEQLKTDMESDAVATIIARTRQAAEALKLTGTPALVIGETVVRGAVDIDEFRRLIAA
    ERAKQG

    >gi|294084667|ref|YP_003551425.1| hypothetical protein SAR116_1098 [Candidatus Puniceispirillum marinum IMCC1322]
    MTKTDITYKSITTSISRRHFSSGLFGAAITVASPFVASMQALAADDDIIAHISAPRIMGNAKAPIKVVEYFSMTCGHCAN
    FHNVTFPKVKSDMIERGLIQFEMRPFPLDGLALRGHALARSLPATRYFPMVKALMSQHKQWVRAEDPLAALMKIARLAGI
    SGAEFNKIMSNRALLEKLVEMRQAALDDWNVSSTPSFVINDDKLLSGNMNYETFAEEINAYGA

    >gi|294084678|ref|YP_003551436.1| Redoxin domain-containing protein [Candidatus Puniceispirillum marinum IMCC1322]
    MTIVAGQNMPSANFQIKSDEGINAFSTDDYFKDCRVVMFAVPGAFTPTCSARHMPSYLEHADALKQAGIDKIACLSINDA
    HVMHAWGETNQADGIIDMIADMDGSFSRALGIEVNMGAILGKRATRCAMIVDNGLVTHVLMEEPGEFVVSSAENVLATLN
    A

    >gi|294084679|ref|YP_003551437.1| putative suppressor for copper-sensitivity B precursor [Candidatus Puniceispirillum marinum IMCC1322]
    MKNSLSLKSDRYSLSVWHICQREVTYLLMALITLIPSIFMPSSANAADSIWIGDPSMAEMRLISAVDGTGRLENIPLGLE
    FRMAPGWKIYWRTPGEAGLPPSINLDQNFNKALSAQVAWPAPKRFNAFGFDNFGYAEHVVLPISLAGHISGTPLQLTADV
    EALVCADICVPLAGTLDLDIANGVAMPTIHTQMIAEYASAVPRPGSAPNINAQAIWHDRENLYVRFAALTAPIEDIFVEG
    IDGVAFKKPEMNGQTARIAMQGTLPENMIGMPVTLTVVGQPSRAGLGKGDIELAEARLFIGTASEVTHSDSQTTASLALG
    AILFTAFLGGLILNLMPCVLPVLAIKVTSILSVAGMSAGHVRRRFLASAAGILVSFMILAAGLGTLRYAGAQIGWGIQFQ
    NPVFLIAMALVISLFALIMLDRVTVPIPAFVSRLSAGAGSGYAGDFLAGMLATLLATPCSAPFVGTAITAALTGNDIMLV
    GIFAAMGFGLALPWLLLALWPQAVAFLPKPGRWMVSMKYVLALFLGGTVIWLLTIFHTLGGSDATRAVVVILVLGFGLVA
    FRGFTVRIARLIMSFTVVAALAVPIMMSPDLPEQPLPEAILGVDVAWQPWHVKGIDMYLAKGQVVFVDVTADW
    CITCKVN
    KRFVINDPAIAARLGTARQQGKLVMLQADWTRPDRDISRFLAQYGRFGIPFNAIFSPSHPSGIILPELLTTDIVDRHLDL
    AGLGVN

    >gi|294084718|ref|YP_003551476.1| disulfide bond formation protein DsbB [Candidatus Puniceispirillum marinum IMCC1322]
    MCIWQRWPHAIVILMSLFGLRGFAPSAMMGLIAITAAISVGLGGFHAGVEWQLWQGPSGCTAALQSNMAVTDLVDQLLAT
    PVVRCDEVAWSFLGISMAGWNAIFSLDMFLIALLAMLGRDNIKNQNPGTR

    >gi|294084827|ref|YP_003551587.1| thioredoxin [Candidatus Puniceispirillum marinum IMCC1322]
    MATTKTTDSDFSTQVLQSDKPVLVDFWAEWCGPCKAIGPALEEISEDKGDSLSIVKLNIDENPLTPQQYNVRGIPTLLIF
    KDGAVVAEKVGALPKSQLENWIEQSI

    >gi|294084891|ref|YP_003551651.1| pyridine nucleotide-disulfide oxidoreductase dimerization region [Candidatus Puniceispirillum marinum IMCC1322]
    MKTIKADIVIIGAGSGGLSLAAGAAQMGAHVVLFEGSAMGGDCLNSGCVPSKALLAAGKAAHNAHSKANFGVHVADTKID
    FAAAKDYVDTVIGTIAPHDSVARFTSLGVTVISEFARFKTAHIVVSDTYEVTAKYIVIATGSTASVPPISGLDSVPYYTN
    ETIFTDHDKPDHLVIIGGGPIGIEMAQAHCRLGVKVTIIEALAVMARDDQELVSILKNQLINEGVTIIEGAGVTKITQTT
    NSVAQNNENINVQLADGQVLHASHLLVAAGRRPALERLDLDAAGIKHNRAGIITDERLRANKKHIFAIGDVAGRQQFTHI
    AGYHAGIVIRNILFKLPAKIDDKAIPWVTYCDPELAHVGLTTDEAHARFGADRIRVLKAPLSGNDRAIAESRTEGMVKVI
    THKKGHILGASILAPNAGEMILAWAVAITAGQKIGTMASVIAPYPTYGDASKRAAGSFFTDKLFSPRMRRIVQFLMKF

    >gi|294084976|ref|YP_003551736.1| thioredoxin reductase [Candidatus Puniceispirillum marinum IMCC1322]
    MSASSSTHEHVVIIGAGAAGLSAGIYTARANLSPVIIAGLQPGGQMTITTDVENYPGFADVIQGPWLMTEMQTQAENVGA
    RVIYDLVTTIDASTRPFRISLDSGASMTADVVILATGAQARWLGIDSEQTFNGRGVSA
    CATCDGFFYKGRDVAVIGGGNT
    AVEEALYLANICNKVTLVHRRDSLRAEQIMQDRLFKKDNISVEWNREVAEVLGDDGGVTGVRLASTTGEADKEIAVHGMF
    VAIGHDPATAAFKEAVELDDEGYIIAEKGGTRTSVDGIFAAGDCVDKIYRQAVTAAGMGCMAALDAERWLGEQS

    >gi|294085021|ref|YP_003551781.1| Thiosulfate sulfurtransferase [Candidatus Puniceispirillum marinum IMCC1322]
    MQITAQKFVAKMIILGTFIMSAFIMAPITAFATPLVSAAWLSEHLNDENITVIDLRNKIDKGNYETFLEGHIPGAIHSNY
    LTDGWRVGRDGIVGLLPEAEQFESLARRLGVSASTHVVIVPAGVSSTDFGSSARAYWTFKVFGHEHVSILDGGFAGWRAN
    YPDQIEQGPFVAPEAGDFVAQFQPELYIGTEDVASYVNNPGEAVLVDGRNTSQFYAEAKHPKAEKAGRIPSAILISQAHA
    YADDENRLKSREELENIYDDMDDKTIVSY
    CNTGHWAATNWFVMSEVLGHDNVRLYDGSMVEWTAHSDLPLDTSAMSNMDK
    LKKLMGDLLS

    >gi|294085023|ref|YP_003551783.1| arsenate reductase [Candidatus Puniceispirillum marinum IMCC1322]
    MDEVTIYHNPRCSKSRQTLALIRERGIEPTIVLYLDNVPSQSEIKELLAKLGLGARDILRTGEADYKAHIAPLPTLDDAT
    LDDVIIALMTHYPKLIERPIVTYGDKAVIGRPPEAVLTLL

    >gi|294085134|ref|YP_003551894.1| UBA/THIF-type NAD/FAD binding protein [Candidatus Puniceispirillum marinum IMCC1322]
    MLNDDDLHRYARQIIMPEIDEQGQQTLAAAKVLVIGAGGLGAPVILYLAAAGIGQLTILDDDKVALTDLNRQIIYAMPDI
    GAGKARQAASAATNLNPVITPTYIDARLNPDNAETLIKAHDIIVDCSDNPDTRQLVGRTCHHMQRPLVFGGAVQLEGQIS
    VFQSGLDGHADAPCFCCVFPAMPDARQAPR
    CSQVGILGPVTGIIGAMQALETIKLCLGLGTNLTGKLVLFDGRDMRMMEI
    ATAKNPHCPCCGIQPLHNED

    >gi|294085211|ref|YP_003551971.1| 6-O-methylguanine-DNA methyltransferase [Candidatus Puniceispirillum marinum IMCC1322]
    MTEQFYITFHTPLGWMRPISDGTSLIRLDWQQSPWRNGYDGAQEPIDHVSRETKQQILDYLAGTRTSFDLPLAPEGKSKS
    GCDWLSIMAQIPYGTTVSYKQFAAMADKPNAPRAAGSACARNPIPIIYP
    CHRVVRSDGSLGNYGGGDMSSPKDPENLGRK
    DWLIKHEHGHR

    >gi|294085367|ref|YP_003552127.1| thioredoxin [Candidatus Puniceispirillum marinum IMCC1322]
    MEQIIAGASASPVDVNMNNFMAEVIDGSSQMPVIVQFWAPWCGPCKQLGPILEKVVGANAGKVKMVRVNIDENAEIAQQM
    RVQSVPTVFGFVNGQPVDGFAGAQAESSIKQFVAKLIASGGGGADAASMIEAGNEAVDQQDFAAAMTHFQQAMEADPESA
    EALGGVIRCLTGMGDHASARDVADQLSDEYKENKAIITAIAALDLAERAAESAGGLDAARAVVAAEPENLDARQELAMAL
    FAVGENAAAMEQLLESIRIDRTWNDEAARVQLLDFFTSIGVANPDVMRARRKLSTLLFS

    >gi|294085403|ref|YP_003552163.1| dihydrolipoamide dehydrogenase [Candidatus Puniceispirillum marinum IMCC1322]
    MTDSNFDLIVIGAGPGGYVASIRAAQLGMNVACIDRRETLGGTCLNVGCIPSKALLNASEHYANAAGDTLANLGITTGAV
    KLDLAQMMASKDKIVGDLTSGIDFLFKKNKVTRLVGTARIDGAGAVTITSGKDKGAYKAENILIASGSHPSSLPGIDIDE
    DRIVSSTGALALAKVPKKLVVIGAGYIGLELGTVWARLGAEVEVIEFLPRILPGMDSEIAKKFMTIAKKQGLSFKLKTAV
    KSAKASKTGVSLTVEPAGGGDAETIKADIALVSVGRHPAIDGLGVDKIKLALSERGRIKVDARFETNIEGIFAIGDVIDG
    PMLAHKAEEDGVAAVEMMAGKAGHVDYDLVPGIVYTAPEIATLGKSEDMLKEAGIAYKVGSFPFSANSRARAQGHSEGFV
    KILADAETDRVLGVHIIGHEAGTVIHECATAMAFGASSEDIARTCHGHPTLNEAVKEAALAVDGRAIHM

    >gi|294085435|ref|YP_003552195.1| thioredoxin family protein [Candidatus Puniceispirillum marinum IMCC1322]
    MLYTRLLPNYQPKTCAKMTALSRRQFASVIGVTLLVPFLPVSAGATPMPDVHPTPSMQAKILDVEGQAFQISDFKGIPVL
    VNFWATW
    CAPCIAELPALNQAAISLADINLVILLVSIDRGGPDKALPFLQDRGIVETDGKAGMRFGFDRKANLPREMGVS
    GVPTSFLLSSDQAKSWLFKGPYEWDQPEMLTHIRSLVG

    >gi|294085485|ref|YP_003552245.1| glutaredoxin 3 [Candidatus Puniceispirillum marinum IMCC1322]
    MAKIEIYTQMGCGYCARALRLLQAKNVPFEQIDVSLNSDLRGEMTKRSGGRTTSPQIFVDDEHIGDSDEIFALDRAGHLD
    KLLKLGS

    >gi|294085539|ref|YP_003552299.1| UBA/THIF-type NAD/FAD binding fold protein [Candidatus Puniceispirillum marinum IMCC1322]
    MMPLSDRYDRQMILPEIGADGQAKLATVKMLVVGAGGLGAPVLSYLAGAGIGHITIIDHDLVSASNLHRQTLFTQSQIGQ
    SKAELAAKFCSHLNHEIDVTAINQKLTPLNADGLVAMADIVLDCADSFAASYILSDICRDSATPFISASALGMGGYVGGF
    CGMAPSLRAVFPDLPADLAS
    CASAGVLGPVVGVLGSLQAQMALTIALGLIPSPLGHLIRYDASTMRTAHFRFDEAPEPTT
    IHSFIDASAIRDDDFVVELRGMDEAPIPVTPNARRFDVATIATQFPTDTAYSRVVLCCRSGLRAWRAAHIIHPKWNGEIA
    LVAAT

    >gi|294085587|ref|YP_003552347.1| hypothetical protein SAR116_2020 [Candidatus Puniceispirillum marinum IMCC1322]
    MSVMTQNMNEMLLRAEADGRGYVVAAMYKFVTLTDIETLQQTIINLCTSHQALGTILLANEGINGTIAAPIDGMTGILEW
    LEADSRFGGMSLKFSHSPTQPFLRMKVRLKREIVTMGCPEISPAERTGTYVEPKDWNALISDPDVLVVDTRNVYETAIGM
    FDNAVDPMTTNFRDFPDWAARLAEQQAPAKPKKIAMYCTGGIRCEKASALMQDYGFDEVYHLQGGILKYLEDVPKNDSKW
    QGECFVFDGRVAVDHNLNPGSYGMCHGCRMPLSQDDMQRPEYVEGISCHHCQDTQDPERTARFAERQKQIQLAKHRGEAH
    LGASPRNSK

    >gi|294085624|ref|YP_003552384.1| putative Zn-dependent hydrolase including glyoxylases /Rhodanese-like sulfurtransferase [Candidatus Puniceispirillum marinum IMCC1322]
    MIFRQLFDNVSSTYTYLIASRKGGEALLIDPVLEKTEHYLTLMEQLDLKLVKVLDTHVHADHITAMGALRDRTSCVTVMG
    EQSPVDVVSMRVSDGDAVDIEGFSLTAMYTPGHTDDSYCFRTDDRIFTGDTLLIRGTGRTDFQNGDAGRQYDSLFNGVLK
    LPESMLVYPAHDYKGDTVSTLGEEIAYNPRLQVKSREEYIDVMNQLNLPNPKMMDVAVPENMKVGLNLERQRQVPTIEAG
    ALLGREVDKLILVDLREDTERARFGVIPDSIHVPYGQLEMQLATLAQTDGRPVVFY
    CAVGERSAMATRLAHANGIDHCAH
    VPGGFQAWQSVGGAIKEV

    >gi|294085803|ref|YP_003552563.1| AraC family transcriptional regulator [Candidatus Puniceispirillum marinum IMCC1322]
    MTNQSQIDYERVERAIGYIARHFKDQPSLEDVAAEIHVSPFHFQRLFSKWAGISPKKFIQFLSLDYAKASLRAPGTSVLD
    AAYDAGFSGAGRLHDLFMSIEGMTPGAFKQQGAGLTINYDFADSPFGTVLIASTRNGICHLAFEADRDAGFDTLYRTFPQ
    ARFHQCRDQMQTHALSVFGRNQASPDGKIKLHLQGTPFQIKVWEALLKIPMGELASYGGIARMIGQPAASRAVGTAIGHN
    PVAFLIP
    CHRVIRQNGALGGYMWGAERKQAMIAWEGAQMTG

    >gi|294085930|ref|YP_003552690.1| phospholipid hydroperoxide glutathione peroxidase [Candidatus Puniceispirillum marinum IMCC1322]
    MFEPASHIAFVAPSKSVSIWAIILLFVTFVTEPLMPAHAKNAHDISFENIEGGTLDLAEFRGKVILLVNTASQCGFTPQY
    EALQAMWDNYRDRGLVVIGVPSNDFGGQEPGANSQIKQFCTINYGIDFPMTEKVAVTGSDIHPYYQWVLEAGGRLAMPRW
    NFYKHLIDQEGNFVTWFAATTAPDARKIRQAIEKLLPN

    >gi|294085935|ref|YP_003552695.1| glutathione S-transferase [Candidatus Puniceispirillum marinum IMCC1322]
    MIMLTLYYSKMSCAYAPHILLYDAGAEFTAMPVDFETDEQNKPAFLAVNPKGRVPALVTPQGILTENPAILLYIAQLNPD
    KQLAPTDPFLLAQAQAFNMFIASTVHVAHAHRHRGYRWADDEAAQASMSAKVAENMTLYAQMIEDHYFIGPYVLGDQYSL
    CDPYLALIIRWFGGDGVELDHFPKLKQHDAMMRARSSVQAVMPFYI