Candidatus Protochlamydia amoebophila UWE25 uid58079

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|46445658|ref|YP_007023.1| proteins related to alkyl hydroperoxide reductase (AhpC) and thiol specific antioxidant (TSA) [Candidatus Protochlamydia amoebophila UWE25]
    MNGQIVNDFSLLHFRGQNVILFFYPLDFTFVCPTELHAFQEKLEEFEKRNAQIIGCSVDSCYSHLAWLNTPKSKGGIEGI
    DYPLISDLNKTIAHDYDVLIPHEGIAFRGLFLIDKEGIVRHQVINDLPLGRSVDEALRILDALLYFEKNGEVCPANWQHG
    QKAFKPSNEGLEEYFATVPVSRPKI

    >gi|46445712|ref|YP_007077.1| putative copper-transporting ATPase [Candidatus Protochlamydia amoebophila UWE25]
    MEKKKLLIRGMHCVSCAQNLENSLKKVSGLQEIHVDYSTSQADIIFDENKVSFASLEKHIKKMGYESYSFRPSLDEDRRI
    KQKEIQNTFKTFLIAAVLSLPFVIQMLAMMLGYAFSIPPTWQFFLATLVQFGCGGTFYRSSFYALKNWQINMDVLVVLGS
    TAAYLFSFYVYLLKLSYSFYFESSALIITLILFGRWLEAVTKGKTSKALERLYHLQPKIARIEKNGEIIEVDVASIQVGD
    IFMVRPGDHIPVDGWVIEGESSINESLLTGESLPVYKKQGSKLYAATINETGYLKGQASSVGSDTILAQILRAVEKAQSS
    KAPIQKFVDKISAVFVPCVLLISCLTILIWTFLIGDFTNGLINAVSVLVIACPCVLGLATPAVLVVASGVGAQYGIFFKQ
    ASSIEQSEKIKFLFLDKTGTLTKGIPSVMGIYPNAKYLKNDVLQIAASLENCSSHPLAKAILNEAKEEGILLKIVKEFNS
    FIGKGVTGTIDEKVYYLGSANFAKEMGIEIDPAFSLLEEQGESLVFVWTDHQLLGMITIMDELRKESMEVIRLLKLKGIY
    PILLTGDRKYVAETIAKKLGIEDARFELLPDDKMQIIREAKNSGKVGMIGDGINDAPALAEADVSFALAFGSDIAIEVAD
    ITLIRNDLMSLVDAIDLSQQTMRKMKYNLFLAFIYNVLAIPLAAFGLLNPMIAAGTMAMSSVSVIANALLLRYWKPEINR
    NNVERIVKV

    >gi|46445725|ref|YP_007090.1| putative bacterioferritin comigratory protein (BCP) [Candidatus Protochlamydia amoebophila UWE25]
    MNLPVSVRQQVPSFKAFDEQNQLFSSTNLLGQIYVLYFYPKDDTPGCTLQACQFRDIKTSFEKFETRIIGISPDSLKSHE
    KFSHKYQLNFTLLSDSSHEMCDLFGVWQEKKIFGKTKMGVIRSTFIVDAKGLIRWIESPAQVDGHAERVLKAIQILKNGE
    MI

    >gi|46445785|ref|YP_007150.1| dihydrolipoamide dehydrogenase [Candidatus Protochlamydia amoebophila UWE25]
    MMEIKKFDVAVLGGGPGGYPAAIRAAQRGKSVALIEAKELGGTCLNRGCIPSKALIAGAEVVDRIHEAKEFGIHVGEVNI
    DYAQLAFHKDRVIERMRKGLEGLMATNKITVFKGFGQFISPREIKIKGQDNTSITADQIIIATGSEPRNISAFPFDYERI
    HDSTSLLAMKTLPEKLIIVGGGVIGCEFASLYATLGVHVTILELLPRLISSEAIEVSQALTKAFIKRGIQVETGVKVQKI
    EQVEMGIQVQVEEGKHYVADCCLVAVGRSLNTKNIGLDKAGILVQENGMIAVNDKMQTNVDGIYAVGDIASKWWLAHVAS
    HQGLIAADQICGKSSRMYYHAIPSVIFTHPEIATVGLSLEEATKRGYKAKLASFPFQALGKSQAALQAEGFAQIVVEEKS
    GQILGAQVVGYEASVMIAEMTLAIANELTVECVAETIHAHPTLPEAWLESALLGEGLPLHLPPKTQKKG

    >gi|46445932|ref|YP_007297.1| Na(+)-translocating NADH-quinone reductase subunit E [Candidatus Protochlamydia amoebophila UWE25]
    MWMGPYSVLNLFGLLLQAVFIENFLLVNFLGMCTYLACSNKLKTANGLGIAVVFVLTVSGVLNWFVHRFVTGPGALTWLS
    AFGIDSSQVNLGFLEFLLFISVIAGFTQILEIIIEKVSPALYMSLGLYLPLIAVN
    CAILGACLFAVTRDYPFFPNLIYVF
    GSAVGWWLAIALIAAIREKIAISNVVPELKGMGITFIMSGLMSMAFMGFTGIKLADPSPPEATSEQPLKELALSDDSSSQ
    ETLTLSK

    >gi|46445933|ref|YP_007298.1| Na(+)-translocating NADH-quinone reductase subunit D [Candidatus Protochlamydia amoebophila UWE25]
    MSQPEPPVSSYFTSQIWSSNQVLVAVLGICSALAITNRLSVAITMGLSVSFVTAFSSLFVSLLRKITPDSVRMIVQLAII
    SVFVIIIDQFLQAYFFGISKVLSVFVGLIITN
    CIVMGRTEGMAKNVGPLAAFLDGLGAGTGYAIVLFIIAFIRELFGFGQ
    LFGYQVIPQSWYATAANPDGYENFVLMVSPPAAFFLIGGLIYVSKKMQGNA

    >gi|46446013|ref|YP_007378.1| thioredoxin [Candidatus Protochlamydia amoebophila UWE25]
    MSDKLVHLNDDNFQQTISQGVTLVDFYATWCGPCRMIAPIVEQLSTTLQGKAKVAKLDIDQAQSTTADLQITSVPTLIVF
    KDGKEVKRVVGVKDLDYLLNLVQSFT

    >gi|46446359|ref|YP_007724.1| soluble pyridine nucleotide transhydrogenase [Candidatus Protochlamydia amoebophila UWE25]
    MEEIKTDIVIIGSGPAGQKAAIQAAKLGKNVIVIEKEPELGGACLYSGTIPSKTFREAVVDLTRFHDRHFAGKDYILPNV
    TIDELNVRLHTVINEERNIITRQFKKNSIRVIQGSARFENQHTLIVVDNDFRLKYQIKATSFIIATGSNPRNPPDVPFDQ
    QVILDSTTLLGIGRVPKSMIVLGGGIIGSEYASFFAALGTEVTVIDRKDHMLPLLDAEIGIHLQTALTDIGLKFLGKKEP
    VEISRVEDHAYVKFKDGSSLEADVLLYALGRLANIEALHVENTGIIVDAKGYIPVNALFQTVIPHIYAVGDVIGGPCLAS
    TSMEQGRLAARHACGVQTHHFPTFYPVGIYTIPEISSCGYTEEELKAWGFHYEVGRAHYYEIARSHIAGSNTGLFKILFH
    AETLEILGVHVIGRNATEVIHIGQMGISFRAHIDYFIDHVFNYPTYAEGYRVAALNGVNKIKFKK

    >gi|46446443|ref|YP_007808.1| putative copper-transporting ATPase [Candidatus Protochlamydia amoebophila UWE25]
    MHQILATQQALNNVSEHPLFKQALKSGLIANPRLLEEINSQKIGEKETLEKLHLEIHDMWCPSCAEVIKLTLLKEWGIAY
    CYVDYTTDSATIEYAPVHITKERILKLISNLGYRPNFLQDPRQQVLSRTLSLRFVIAAFFSMNIMMFAYPIYVSFFNEQA
    EGYAQLFAWLSLIGALPVLTYSAWPIWKRFYTGAKVGLWGMEALVVLGVAAATGLSIYEMWRGSSYVYFDSMTVIIVFVL
    LGKMIESKAKFSAKDSLVQLTRALPRRGRKKISATKNEFVSLKEIHIGDLLVVLSGEKIVLDGIVEEGEGICNESLMTGE
    ALPVPKNVGMDVLAGTILQQGSLVIKVTATSEQTALFQIVEMVEQDIGHKAQYVRTIDSIVKWFVPFVLCLAIGVFVYCL
    LFNQQDFDQTSLQSGIIRAVSVLLISCPCAIGIAVPLVESQLLNAFAKLGVIIRNRACLALLGKETILVCDKTGTVTEGK
    YTVLSGYEKLSLEEKSVLKALVSHSNHPIARSVDQAIIDFEESNIEKIEEIIGRGIRGYQGKIPYYFGSAIFLQQQGIST
    PLIHLRKNMEAQTTVFFAKQNICLAAIHLGDRIQPEVQTLIQSLKGIKTLLLSGDSSLAVEAVARLCGFQEWFAEYHPLQ
    KRELIEKLKKQGEIVMMIGDGINDAPALTASHIGVAVMSATDISIQVSDILLTTNRLQILQKMHHLAKKGHKIIKQNLFW
    AFFYNCIGLGLAVYGSLTPLFAAFAMVMSSLLVLINSKRVYLNK

    >gi|46446446|ref|YP_007811.1| hypothetical protein pc0812 [Candidatus Protochlamydia amoebophila UWE25]
    MHTQLTSTSNSFSQRNFWIVSLSLISGLILSILSWLELCVEHCSANQEYRLFGMPFALAGMAFFPVMLAIHFFSKKFPSL
    SKLTSWSLAAAFGAEIMFILIQKYEIRHWCPVCLGIALTVTIACIARALPYFKTFYSAIQQGEFMTKIKQGLLSLSFIIL
    GFLMAFVGISKVDAAEDAIADMKNRLMFGSKTSPVEVYFVTDWF
    CPSCKKIETQIEKILPDIQNQAALFFVDYPIHNKSM
    NYTPYNLAFLVNAKSNYLKAREVLSQLTEKTETPHDNDVVKAVKAYHIPFKELSFLDVKAGMEFFDKVVKKYDLSATPTI
    IVTNTKTNQVIKFEGTDEISDQNVLNAIQTLSQSHEETSK

    >gi|46446576|ref|YP_007941.1| hypothetical protein pc0942 [Candidatus Protochlamydia amoebophila UWE25]
    MFFQKIYTPGLAINTYLLGDETTKECVVIDPTRVVTPIIMAAENAEMHIKAILETHVHADFISGARELKFQLKNAPIIYS
    SGFGGEQWVPAYADHIVKEEDVLSFGSIRLKPLHTPGHTPEHIMWICYDETRSHDLPWFIFSGDCLFVGSVGRPDLLGEN
    AFNFLAKELYQSLFVRIAHLPDSVEVFPAHGAGSLCGKNIGGVDATTLGYERTCNPYLNPIEETEWIKSISQDLPAIPPY
    FSLMKKINVSNPPLLSELKVEKVCSERDLDLNLCFLLDVRYPELFARFHLPGSVNIPMTPSFYSWAGWLIPHNIPLIIIT
    NRENQMNDIVSQLRLIGFDQPFYLFVLKDDAEKKMNRIECFSYLTPEELAKRLHDPKENVFVLDVRTTSEWHSGHIADAY
    HVELNNLYQYMHKIPQNRLIAVI
    CRSGIRASTAISLLKKYGFNHVVNVRGGMQAWIDLEFPIITSDKE

    >gi|46446581|ref|YP_007946.1| putative thioredoxin [Candidatus Protochlamydia amoebophila UWE25]
    MKVLNYLLCLFICLTALVYSEIKSVKDKICCDLNASSIVEVTQDNFKQLIFPEKPVILMIYAEWCGCCCRFQPILETFSE
    SFKESIRFAKLNYDEETDLADSFDINYFPTFIFIDSGIVMDKTDEIDTQEELESQIFAWINQLN

    >gi|46446598|ref|YP_007963.1| bifunctional methionine sulfoxide reductase B/A protein [Candidatus Protochlamydia amoebophila UWE25]
    MKKYHSLTPEENSVINFKGTEYPNTGKYNHFSEPGVYVCKKCDAPLYLSSDKFLSHCGWPSFDDEIKGSVDKKVDSDGRR
    IEILCHRCGGHLGHVFKGEGLTTKNLRH
    CVNSVSLSFLPALTKESYERALFAGGCFWGVEYLFQKLTGVIKTKVGYSGGV
    TIDPTYEDICSGRTKHAETLEVVYDKNKITYEALAKFFFEIHDPSQFQRQGPDIGNQYRSAIFYLTKQQEEIAQCLIQLL
    STKGIPIVTEVIPASVFYPAENYHQNYYGKTGKTPYCHIYTKRF

    >gi|46446719|ref|YP_008084.1| hypothetical protein pc1085 [Candidatus Protochlamydia amoebophila UWE25]
    MSCCSKPHQDDHHSHSHSHSHSGGCCSPAPSPQEHQHSGGCCSQQPKKAATEISRSMTIEDILGMFPYKAQKLSQEITNA
    GLHCVG
    CHAAVWETLEAGMMTHGKTDAQIDELVRRLNALLQEPVDQSSICITPRGASKFLEILADENKQGWGMRFAEEMA
    G
    CNGFEYVLDFSEKADAEDEIFSSNGIEIHVKKAMVPRLLGSEIDFVDGLRGSGFKISNPNVRSSCGCGSSHNY

    >gi|46446722|ref|YP_008087.1| dihydrolipoamide dehydrogenase precursor (E3 component of pyruvate dehydrogenase multi-enzyme complex) [Candidatus Protochlamydia amoebophila UWE25]
    MVEHYDLAVVGAGPGGYVAAIRAAQMGLKTICIDKRETLGGTCLNVGCIPSKTLLHSTDLYSTLKQHGLEQAIEVSDLKV
    NFTKLMERKRNVVKGLIEGIALLFKKNGVIYLKGEAQFLDAHTLQVKNGTHIDEIKANYILLATGSESTSLPHLPFDEKN
    IVSSTGALNLATVPPRLLVIGGGVIGVELASVYNRLGSSVTIIEMSDRLCPAMDIALSKYLFQILKKQGIEIKLSTKMMT
    AVLQPNETILTIEQNEQLQNISGEVVLVAVGRRPYTQGLALDKVGIQIDKKGFIPVDGFFRTSQPHIFAIGDLIEGVMLA
    HRASQEGITVVEWLKGERQSINYLAIPNVVYTNPEVASVGLTEQEASESGLTLLTGTTYFRGNSRARCTDEIEGFVKLIG
    EKKSGRLLGMHIIGAHASELIAVGTLAIQKQINLKDLAETVQAHPTLSETIKEAALQALGKAVHG

    >gi|46446752|ref|YP_008117.1| hypothetical protein pc1118 [Candidatus Protochlamydia amoebophila UWE25]
    MGYNRLLKSFKKYQKQAHLFPKLSYNRCRRMSDKPLYTNRLIHEKSPYLLQHAHNPVDWYPWGEEAFHIAKTQDKPIFLS
    IGYAT
    CHWCHVMERESFEDIEVADSMNQTFVSIKVDREELPEVDSLYMEFSQSMMAGAAGWPLNVILTPDLQPFFATTYL
    PSHSSHGMMGLIDLIQRIAELWSSEEREKIITQAEKIVEVFSKAVHTTGEDIPDEEQISITADLLYKMADPTYGGIKGAP
    KFPIGYQYSFMLRYYANMKDSRALFLVERTLDMLHRGGIYDHLGGGFSRYSIDEKWLVPHFEKMLYDNAILAQSYLEAWQ
    LTKKNLYKEVAQEILNYILRDMTYSDGGFYSAEDADSEGHEGFFYTWKEEEVKEILGDHSQLFCEYYDITAEGNFEGRNI
    LHTPLNLEEFASKHQQDIDQLRIIFDNQRKKLWSAREKRIHPLKDDKILSSWNGLMIYSFAEAAFTFDCPLYLEAAVKAA
    RFIKNKLWKNQKLLRRWREGQAMFQAGLDEYAFMIKGALSLFEANAGTEWLEWAIEMATLLKDQYKAEEGAFYQTDGGDK
    NLLLRKCQFSDGAEPSGNAVHCENLLRLYQLTNEEDYLAQAEDIFKGVKEYLENYAPGYCYHVMNLLRYYDDTSPTIVIA
    LNSTREHEQAIKQLLYQNFIPHKAIIWQTQDLQLEEIIPYVKEQEARDDQTTLYICYEGACQQPIIDLKQMKEAIEKL

    >gi|46446768|ref|YP_008133.1| hypothetical protein pc1134 [Candidatus Protochlamydia amoebophila UWE25]
    MNFHTFKSIALHFIFSFFLLMSIGLTAKEEICEKNLKQRIVLGKSDSPIEIYIVSDWFCRSCKKLEPRLENLYDKFKNKA
    AFYFIDYPINRQSSNFSPYHLSFLIFEKKNYLKARQALICLTKENQKPTDSDVEKIAKCNKLNFQELAYEDISKGIDFFD
    SIVKKYQIDATPSVIVVNKNNKQFEIFKGGQAKEEAISEAIDVLEGKAKPKKKSWFKSIFGFST

    >gi|46446782|ref|YP_008147.1| hypothetical protein pc1148 [Candidatus Protochlamydia amoebophila UWE25]
    MTRISPITKEEANQNITQIYSGLEKKMGRVLNIFQNMGNSEAALKGYLGLSEAASQTSLSPKLREQLALVVGQTNDCQYC
    LSAHTVSAKLAGLQEKDILESRLGHSQDKKTEAILTFAKTIVERRAQVSDQDIEKLKSAGISDQEIVEIILVVVLNIFTN
    YFNHITDPQIDFPFAPKIN

    >gi|46446968|ref|YP_008333.1| putative thioredoxin peroxidase [Candidatus Protochlamydia amoebophila UWE25]
    MPFIPLIEVLLCNNQLTLYNEVIEKFKRFKAQFVEISVAEICSHLAFFHQKKLGFPLLSDFEPKKEIFKAYGVFRNEEGV
    SKRALFVINGKGIIL

    >gi|46446969|ref|YP_008334.1| hypothetical protein pc1335 [Candidatus Protochlamydia amoebophila UWE25]
    MMPQLSTPISEKDHILGNLNAPVVLVEYGDYQCKTCALTHPIVKQLLKEMRGQLCFAFRHFPLKNSHPLAFIASQAAEAA
    ALQNKFWQMHECLYHHHHALSLEAFPSYAEEIQLNIKLFNENLQNPSLISCIEENFCSGLDSGVNGTPCFFINKERYDGD
    RSYDTLLSALKNAVS

    >gi|46446978|ref|YP_008343.1| putative arsenate reductase [Candidatus Protochlamydia amoebophila UWE25]
    MIIYVYSKCSTCQQAIRFLKQKKLFFTCKEILEQAPSLQELQKMFHYQNENLKKLFNTSGKLYRELQIAEKMPSLTKEDA
    LVLLSKHGMLVKRPFFLGEGFGLVGFKEEEWNYYL

    >gi|46447234|ref|YP_008599.1| hypothetical protein pc1600 [Candidatus Protochlamydia amoebophila UWE25]
    MKKITNFLISGTLTLTAIIPLFGQSPSNQQAYPNQTYAQPTTTKGQMNQSKTHDQSSRHFGSQNLNEHSLTWITNYHEAV
    AQSQSTGKPIILLFTGTNW
    CPACMKLEKEVLTKPEFAQGVGNQFIFFKAEFPDYGEDAIMSSPYSTLLQRYNINAFPTLV
    VINASGQLLFTVNYKAGGPTVYINELLQKLNPGQFSGSMNHFNTYYR

    >gi|46447347|ref|YP_008712.1| thioredoxin-disulfide reductase 2 [Candidatus Protochlamydia amoebophila UWE25]
    MEKAKLIIIGSGPAGYTAAIYAARANLEPILFEGFFTGAAGGQLMTTTEVENFPGFPDGITGPELVDRFRQQAIRFGTTI
    ISEDVDSVDFQVYPFIIKGKKSHYQASSVIVSTGATAKRLPIPGAGDDEFWQKGVTA
    CAVCDGAAPIFRNRPLFVIGGGD
    SAIEEATFLTKFGSRVFIVHRRDTLRASKIMQERAFNNPKIEMIWNSEVIQVKGDQIVKNLVIRNVKTGQEKEYEAAGLF
    FAIGHNPNTEFLKNQLELHSNGYLKVFKGTQTSIKGVFAAGDVQDFEYRQAITAAGSGCMAALDAERWLAEKGLDN

    >gi|46447422|ref|YP_008787.1| hypothetical protein pc1788 [Candidatus Protochlamydia amoebophila UWE25]
    MTEKKQFTLPLGSQAPNFNLKATDEKNYQLSDFDSAKLLVLFFTCNHCPYVINSDEITRKTVEKYKDRGVDFIAINSNSE
    TTYPEDSFQNMIERMKQYHFPWTYLHDSSQGIALAYGALRTPHFFVFDDKRRLIYTGRAVDSPREPLKITVNDLEDAIED
    YLHERPIKKPLTNPIGCNVKWKGKDKHWMPDDACDLT

    >gi|46447469|ref|YP_008834.1| putative methylated-DNA-[protein]-cysteine S-methyltransferase [Candidatus Protochlamydia amoebophila UWE25]
    MHNKHVEQIFFSIGNSSFGQVIVAQSQVGLCAVILGENPAELQLLLQARFPQAHLIHDDYKTKNILSQIIELMENPLKKI
    DFTLDERGTLFQRSVWKALREIPIGTTSSYAEIAKKISSPKAVRAVGGACAANPLALVTP
    CHRVIRKDGNLSGYRWGIER
    KLQYLQLESKLKK

    >gi|46447479|ref|YP_008844.1| putative thiol-disulfide interchange protein [Candidatus Protochlamydia amoebophila UWE25]
    MNNYIRFFLLLIGFASPLPSFATFEGSAHVQVQLIQEEETIQPGHPFWVALHLKIEDDWHVYWKNPGDAGIPLKVEWTLP
    LGFEVGPLQWPFPGKFKVADMVGFGYEGEVVLLSLITPPANLSIGQTFQLNAKLKWLVCSDLTCQPGSTTTALQVVTQND
    APKLKTETATLFSQARLKIPSFHAEVKTVRKSGIVQIEMPHANQIPNVDPVIGVYFFPEEKDVIDYKVDPVLAAASKQDQ
    RFLVNLKGSDEIGAKSQTLKGVLVVHTQQGNEESVQAFDIDTPIHEVGEKELISHLDTHSIRSSTLEMETQKTQASSFEF
    EGGIALALLFAFLGGMILNLMPCVLPVMSFKVMSFVKMAGQSRSLTIKHGLMFSLGVILSFWLLASAMLTLRAYGQAVGW
    GFQLQEPIFVVILASVLFIFALSLFGLFEWGMFFASWAGQTQAEKATQWSGYMGSFLSGVLATAVATPCTGPFLGSAVGF
    AVTLPVFQSLLIFTLLGLGMCFPYLLLASFPAFLRFMPKPGPWMETFKELMGFVLLITVLWLMWVFSAQTNTFSLICLIA
    GFLSFAIGAWIYGKGSHPLISSKKRIIAYVTALFFILMGIEAIILPKDSWNDSSTFSQIGNAEWAGWEVFSPERVAELRK
    QGRPVLIDFTAKW
    CLICQANHIVLGSKEVDKKLSEKGVVKMIADWTKNDPVITEALSQFGRNSVPLYVFYGSDQKQEPTI
    LPQVLTSDIVKEHINSVLNSKEVAWIE